KEGG   Erwinia pyrifoliae Ep1/96: EpC_30230
Entry
EpC_30230         CDS       T01000                                 

Definition
(GenBank) conserved uncharacterized protein
Organism
epy  Erwinia pyrifoliae Ep1/96
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: CAX56802
Position
complement(3319610..3320581)
AA seq 323 aa
MNITFSRPRRLALATIMACSGTLASVNTAGLLASAASPDCISWRVSGICYWLMCTPLGCT
VKTSVKVTHFIPQAVVSAWLSPGDNPWTEMSALSATADGAESVLLGGAAGVATGGGRQEM
KVPGMRSQNLHFYYAGAYGHPATKIIGGMVPGYSCDSAATPFIPYFVSALDALAWRTGVP
ESVYPEALIPGQREVGSTPSGNMWGNVYPRSGFVTQTDGYKSAAVVVQRVADIITRQGQL
HVYNPLVGQRSAGYWPPGAVSENSGSKNHKWQRLSPRLSQSCAVFPDVGGQIAQNGNYAW
ALWQPYSCCKRRGQTFLYSTDFS
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaacatcactttctcccgcccgcgccggctggcgctggccacgatcatggcctgtagc
ggcaccctggccagcgtcaatacggcaggcctgctcgccagcgccgccagtccggactgc
atcagctggcgcgtcagcggtatctgttactggctgatgtgtacgcccttaggctgcacg
gtcaaaacctccgtcaaggtgacgcactttatcccgcaggccgttgtctccgcctggctc
agtccgggcgacaatccctggacggagatgtctgcgctcagcgccacggcagacggcgca
gaaagcgtcctgttgggcggcgcggcaggcgtggcaaccggtggtggtcgtcaggagatg
aaagtccccggcatgcgcagtcagaacctgcatttctattacgccggtgcgtatggccat
cctgcgacaaagattatcggcggtatggttcccggctattcctgtgacagtgccgccacg
ccgtttattccctatttcgtcagcgcgctcgatgcgctggcctggcgcaccggcgtgccg
gaatcggtgtatccggaggcgttgatacccggccagcgcgaagtgggcagcacgccgtcc
ggcaatatgtggggcaacgtctacccgcgcagcggctttgtcacgcagaccgacggctac
aaatcagctgcggtggtggtgcagcgcgtggccgacatcatcacccgtcaggggcagctt
cacgtctacaacccgctggtcgggcagcgctcagcgggctactggccaccgggagcggtc
agcgaaaacagcggctcgaaaaaccataagtggcagcgcctttcaccccggctctcgcag
agctgtgcggtgtttcccgacgtcggcggtcagattgcgcagaacggcaattacgcctgg
gcgctctggcagccctacagctgctgcaaacgtcgcggtcagaccttcctctacagcacg
gatttctcataa

DBGET integrated database retrieval system