KEGG   Erwinia pyrifoliae Ep1/96: EpC_30320
Entry
EpC_30320         CDS       T01000                                 

Definition
(GenBank) conserved uncharacterized protein
Organism
epy  Erwinia pyrifoliae Ep1/96
SSDB
Motif
Pfam: FAM199X
Other DBs
NCBI-ProteinID: CAX56811
Position
complement(3333640..3334074)
AA seq 144 aa
MGIMMYDNDNLRMRRHNLLVVMVLLLAGCSTSKDEMLPAGDSSMLELWNNGASSSHATTE
SRTTLRRPVADSERTLAQQTRDSYSRSQQNEIQQTFPRLPNPDMVMYVFPHLAGGNTPVP
GYSTVFPFYGQVQYALPGERTEDL
NT seq 435 nt   +upstreamnt  +downstreamnt
atggggataatgatgtacgacaacgataatctcaggatgcgcaggcataaccttctggtc
gtcatggtgctgttgctggcgggttgcagtacctctaaagatgagatgctgcccgccggc
gacagctcgatgctggagctgtggaataacggcgcatcgtccagccacgccacgacggaa
agccgcaccacgctgcgcaggccggttgcggacagcgagcgcacgctggcacagcagacg
cgcgacagttacagccgcagccagcaaaatgaaatccagcagacgtttccgcgcctgcct
aaccctgacatggtgatgtacgtattcccgcacctggcgggcggtaacacgccggtgccg
ggctacagcaccgtgtttcccttctacgggcaggtgcaatatgcgctgcccggcgagcgc
accgaggatctctga

DBGET integrated database retrieval system