KEGG   Equus przewalskii (Przewalski's horse): 103540259Help
Entry
103540259         CDS       T04644                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04015  Rap1 signaling pathway
epz04022  cGMP-PKG signaling pathway
epz04066  HIF-1 signaling pathway
epz04068  FoxO signaling pathway
epz04072  Phospholipase D signaling pathway
epz04150  mTOR signaling pathway
epz04151  PI3K-Akt signaling pathway
epz04152  AMPK signaling pathway
epz04211  Longevity regulating pathway
epz04213  Longevity regulating pathway - multiple species
epz04520  Adherens junction
epz04910  Insulin signaling pathway
epz04913  Ovarian steroidogenesis
epz04923  Regulation of lipolysis in adipocytes
epz04930  Type II diabetes mellitus
epz04931  Insulin resistance
epz04932  Non-alcoholic fatty liver disease (NAFLD)
epz04960  Aldosterone-regulated sodium reabsorption
Module
epz_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103540259 (INSR)
   04015 Rap1 signaling pathway
    103540259 (INSR)
   04010 MAPK signaling pathway
    103540259 (INSR)
   04066 HIF-1 signaling pathway
    103540259 (INSR)
   04068 FoxO signaling pathway
    103540259 (INSR)
   04072 Phospholipase D signaling pathway
    103540259 (INSR)
   04022 cGMP - PKG signaling pathway
    103540259 (INSR)
   04151 PI3K-Akt signaling pathway
    103540259 (INSR)
   04152 AMPK signaling pathway
    103540259 (INSR)
   04150 mTOR signaling pathway
    103540259 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103540259 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103540259 (INSR)
   04923 Regulation of lipolysis in adipocyte
    103540259 (INSR)
   04913 Ovarian Steroidogenesis
    103540259 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103540259 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103540259 (INSR)
   04213 Longevity regulating pathway - multiple species
    103540259 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103540259 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103540259 (INSR)
   04931 Insulin resistance
    103540259 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103540259 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:epz04090]
    103540259 (INSR)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103540259 (INSR)
Protein kinases [BR:epz01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103540259 (INSR)
CD molecules [BR:epz04090]
 Proteins
  103540259 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Recep_L_domain fn3
Motif
Other DBs
NCBI-GeneID: 103540259
NCBI-ProteinID: XP_008505031
Position
Un
AA seq 742 aa AA seqDB search
MNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAE
LEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWD
WSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELL
TFSHIRTSSDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD
IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTNAT
NPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQEEDSELYELDYCLKGLKL
PSRTWSPPFESEGSQKHNQSEYEESAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVV
FVPRKSSSGPGAEDTRPSRKRRALADVGNVTVAVPTVPGFPNTSSTSTPTSSEERRPFEK
VVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYVSARTMPEAKADDIVGPVTHE
IFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGN
YSVRVRATSLAGNGSWTEATYFYVTDYYVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRK
RQPDGPLGPLYASSNPEYLSASDGEYHPLPCGLSESSVRFPLSGESQRMTPQEAEISPPV
PLACRPAPCCWEQLDTCRPAPV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaattccagcaacttgatgtgtaccccgtgcctgggtccctgtcccaaggtgtgccac
ctcctggaaggcgagaagaccatcgactcggtgacgtccgcccaggagctccgaggctgc
acggtcatcaacgggagcctgatcatcaacatccgagggggcaacaacctggcagctgag
ctagaggccaaccttggactcattgaagaaatttcagggtatctgaaaatccgccggtcc
tacgctctcgtgtcgctttccttcttccggaagttacgcctaattcggggagagaccttg
gaaatcgggaactactcattctacgccttggacaaccagaacctgaggcagctatgggac
tggagcaagcacaacctcaccatcactcaggggaaactcttcttccactataatcccaaa
ctctgcttgtcggaaattcacaagatggaggaagtttcaggaaccaaagggcgccaggag
aggaacgacatcgccctgaagaccaacggggaccaggcgtcctgtgaaaatgagttactt
acattttctcacattcggacatcttctgacaagatcttgctgaaatgggagccatattgg
ccccccgacttccgagacctcttgggcttcatgctcttctataaagaggccccttatcag
aacgtgacggagttcgatgggcaggatgcctgtggctccaacagctggacggtagtggac
attgacccacctctgaggtccaacgaccccaagtcacagaaccaccccgggtggctgatg
cgaggtctcaaaccctggacccagtatgccatctttgtcaagaccttggtcaccttttct
gatgaacgccggacatacggggccaagagcgacatcatctatgtccagacaaatgccacg
aacccgtctgtccccctggatcccatctccgtttctaattcctcatcccagattattctg
aagtggaagcccccctctgaccccaatgggaacatcacacactacctggttttctgggag
aggcaggaggaagacagcgagctgtacgagttggattattgcctcaaaggcttgaagctg
ccctccaggacctggtctccaccgtttgagtctgaggggtcccagaagcacaatcagagt
gagtacgaggagtctgccggcgaatgctgctcctgcccgaagaccgactcccagatcctg
aaggagctggaggagtcctcgttcaggaagacgttcgaggactatctgcacaatgtggtt
tttgtccccagaaaatcctcttcaggccctggtgccgaggacactagaccgtctcggaaa
cgcagggcgcttgctgatgtcgggaatgtgacggtggccgtgcccacggttccgggtttc
cctaatacctcctccaccagcacgcccacgagctcagaggagcgcagacccttcgagaaa
gtggtgaacaaggagtcgctggtcatctccggcctgcgccattttaccgggtatcgcatc
gagcttcaggcttgcaaccaagattcccccgaagagaggtgcagtgtggccgcctatgtc
agtgccaggaccatgcctgaagccaaggcggacgacatcgttggccccgtgactcacgaa
atcttcgagaacaatgtcgttcacttgatgtggcaggagcccaaagaacccaacggtctg
atcgtgctgtacgaagtgagttatcggcgatacggcgatgaggagctgcatctctgtgtg
tctcgcagacattttgccctggagcggggctgccggctgcgtgggctgccgccagggaac
tacagtgtgcgagtgcgggccacctccctggcaggcaatggctcctggaccgaagccact
tatttctacgtgacagactattacgtcccatcaaatattgcaaaaatcatcatcggcccc
ctcatctttgtctttctcttcagtgtggtcattggaagcatttacctcttcttgagaaag
aggcagccggatgggcccctgggaccgctgtacgcttcctcaaaccctgagtacctcagc
gccagtgatggtgagtaccatcctcttccctgtgggctgtcagaatcctctgttcggttt
cctttgtctggtgaaagtcaaaggatgacaccccaggaggctgagattagccctcctgtt
cctttagcttgcagacctgccccttgctgctgggagcagttggacacctgccgtcctgca
cctgtttga

DBGET integrated database retrieval system