KEGG   Equus przewalskii (Przewalski's horse): 103540555Help
Entry
103540555         CDS       T04644                                 

Gene name
GATC
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00970  Aminoacyl-tRNA biosynthesis
epz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103540555 (GATC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:epz03029]
    103540555 (GATC)
Enzymes [BR:epz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     103540555 (GATC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     103540555 (GATC)
Mitochondrial biogenesis [BR:epz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    103540555 (GATC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 103540555
NCBI-ProteinID: XP_008505388
Position
Un
AA seq 138 aa AA seqDB search
MWARAWRLGLRALVGGRRGFTCKADTKGSGRITAEVIEHLERLALVDFGSQEAVARLEKA
IAFADRLRAVDTDGVEPMESVLEDRCLYLRSDHVIEGNCAEELLQNSHRVVEEYFVAPPG
TCSPKWFNRLSYSELRMQ
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgcgggcgtggcggctgggccttcgggccctggtgggtgggcgccgcggcttc
acttgcaaggcggatactaagggaagtggcaggattacggccgaagtgatcgagcacctg
gagcgtctagcgctagtggacttcgggagccaagaggctgtggcacggctggagaaagcc
atcgcctttgccgaccggctccgcgctgtggacacggacggggtggagcccatggagtca
gtactggaggacagatgtctgtacttgagatccgaccatgtgatagaaggtaactgtgct
gaagaactactacaaaactctcatcgagttgtggaggagtattttgtggctcccccaggt
acgtgttccccaaaatggtttaacagattgtcctacagtgaactaagaatgcagtag

DBGET integrated database retrieval system