KEGG   Equus przewalskii (Przewalski's horse): 103540619Help
Entry
103540619         CDS       T04644                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK2-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103540619
   01009 Protein phosphatases and associated proteins [BR:epz01009]
    103540619
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103540619
Protein kinases [BR:epz01001]
 Serine/threonine kinases: Other
  Wnk family
   103540619
Protein phosphatases and associated proteins [BR:epz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103540619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OSR1_C Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 103540619
NCBI-ProteinID: XP_008505452
Position
Un
AA seq 622 aa AA seqDB search
MASFPKYTAQECAGTTLGPGSQYWESRMASPSVTTISILQISKQQWLLRKALSRVRELLH
SRTGYREHQKPLSHRHLQERSSVAGQPYVVIGPHSVGDPGLCHECWRGLQAGLGLGVRGQ
VYRDQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSARGKRCIVLVTELMTSGT
LKTPVVRRGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVT
CGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGR
KSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLERETPDDVAQEMIESGFFHESDLKIVAK
SIRDRVALIQWRRERIWPALQPREQRDPGSPPEADQHLLPPALPASATSLASDSTFDSGQ
GSTVYSDSQSSQRSGVLGSLADAAPPAPCVCSPPVSASTGDGPGLPSSLPAPGPYQQPAV
PGLSLGSIPPPTRPPLPQQRFPEPAVSFAPVPMGPGQPAPPSHQVSPGRPLWPPSCLGLP
GPLALLVLLCGSPGLGGRWTWGLLCLEFMGVSTGRSLACQNDSPRSALPGLQAGGGVCAR
VWCVCTSWFSLSCRGMRGVSAG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcccaaaatacacagcccaggaatgtgccggaaccacgctgggcccggga
tcccagtactgggaatccaggatggcatccccttctgtcaccaccatctccatcttgcag
atcagcaagcagcaatggctgctgcgtaaggcactctcccgggtacgggagcttctccac
agcaggacaggctaccgcgagcatcagaagccgctaagtcaccggcatcttcaggaacgg
agcagcgtggctggccagccctacgtggtcatcggtccccacagcgtaggggaccctggc
ctctgccacgagtgctggcgtgggctgcaggcaggcctggggctgggggttaggggtcag
gtctacagggaccaggaccggaagctcaccaagctagagaggcagcggttcaaggaggag
gccgagatgctgaaggggctgcagcaccccaacatcgtgcgcttctacgacttctgggag
tccagtgccagggggaagcggtgcattgtgctggtgaccgagctgatgacctcagggaca
ctgaagacgcccgtggttaggagaggtacccctgagttcatggcgcccgagatgtacgag
gagcactacgacgagtctgtggacgtctatgccttcgggatgtgcatgctggagatggcc
acctcggagtacccctactcagagtgccagaacgctgcccagatctaccgcaaggtcacc
tgtggcatcaagccagccagctttgagaaagtgcacgatcccgaaatcaaggagatcatt
ggagagtgtatctgcaaaaacaaggaggagaggtacgagatcaaagacctgctcagccat
gccttcttcgcggaggacaccggcgtcagggtggagctggccgaggaggaccacggcagg
aagtccaccattgctctgcggctctgggttgaggaccccaagaaactgaagggcaagccc
aaggacaacggggccattgagttcacctttgacctggagagggagacgccggacgacgtg
gcccaggagatgatcgagtcaggattcttccacgagagtgacctgaagatcgtggccaag
tccatccgtgaccgtgtggcattgatccagtggcggcgggagaggatctggcccgcgctg
cagcccagggagcagcgggacccaggcagcccccccgaggccgaccagcacctcctcccc
cccgcgctgccggccagcgccacctccttggcctccgacagcacctttgacagcggccag
ggctccaccgtgtactcggactcgcagagcagccagcgcagcggggtgctgggctcgctg
gccgacgcggcaccccccgccccgtgcgtgtgcagccccccagtgagcgcgagcaccggc
gatggtcccggcctgccctccagcctgcctgcgccggggccctaccagcagcccgccgtg
cctggcctgtcgctgggctccatcccgccccccacccgccctccactcccacagcagcgt
ttcccggaaccggccgtgagttttgcccctgtgccgatgggcccaggccagcccgcaccc
ccgagccaccaggtgagtcctggccgccccttatggccaccatcgtgccttggtctccct
ggcccgctggccctgctggtccttctctgtggttccccagggctggggggcagatggaca
tgggggctcttgtgcctggagttcatgggcgttagcacggggaggagcctcgcttgccag
aacgattcacccaggtctgcgcttccagggctccaggctggcgggggtgtgtgtgcacgt
gtgtggtgtgtgtgcacaagttggttttctctatcctgtcgaggcatgaggggtgtctca
gcagga

DBGET integrated database retrieval system