KEGG   Equus przewalskii (Przewalski's horse): 103540853Help
Entry
103540853         CDS       T04644                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00480  Glutathione metabolism
epz00590  Arachidonic acid metabolism
epz01100  Metabolic pathways
epz04918  Thyroid hormone synthesis
epz05014  Amyotrophic lateral sclerosis (ALS)
epz05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103540853 (GPX6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103540853 (GPX6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103540853 (GPX6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    103540853 (GPX6)
   05016 Huntington disease
    103540853 (GPX6)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103540853 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103540853
NCBI-ProteinID: XP_008505742
Position
Un
AA seq 221 aa AA seqDB search
MIRQLWASSLFPLFLVGFAQLTPESQKMKMDCYKGVTGTIYEYGALTLNGEEYIQFKQYA
GKHVLFINVATYXGLTAQYPELNALQEELKPFGVVLLGFPCNQFGKQEPGKNSEILSGLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSPKQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMRWFHRASVSTVKSDILEYLKQFTPE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatccggcagctctgggcctcctctcttttcccgctgttcctggtgggcttcgctcag
ctaaccccggagtcacagaagatgaagatggattgttataagggggtgacaggcaccatc
tatgagtatggagccctcactctcaatggcgaggagtatatccagttcaagcagtatgcg
ggcaagcacgtcctctttatcaatgtggccacctattgaggcttgacagctcagtatcct
gaactgaatgcactacaggaggagctgaagccttttggtgtagttttgttgggctttccc
tgcaaccagtttggcaaacaagaaccaggaaaaaactcagagatcctttctgggctcaag
tatgtgcgtccaggtggtggctttgtccccaattttcagctctttgagaaaggggatgtg
aatggagaaaaagaacagaaagtctttaccttcctgaagaactcctgccctccaacctct
gatcttttgggctcaccaaaacaactcttctgggagcccatgaaggtccacgacatccgc
tggaactttgagaaattcctggtgggacctgatggagtccctgtcatgcgctggttccat
cgggcctcagtcagcacagtcaagtcagacatcctggagtacctgaagcagttcacacct
gagtag

DBGET integrated database retrieval system