KEGG   Equus przewalskii (Przewalski's horse): 103541469Help
Entry
103541469         CDS       T04644                                 

Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2-like
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00230  Purine metabolism
epz01100  Metabolic pathways
epz04022  cGMP-PKG signaling pathway
epz04270  Vascular smooth muscle contraction
epz04540  Gap junction
epz04611  Platelet activation
epz04713  Circadian entrainment
epz04730  Long-term depression
epz04921  Oxytocin signaling pathway
epz04924  Renin secretion
epz04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103541469
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    103541469
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103541469
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103541469
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103541469
   04924 Renin secretion
    103541469
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103541469
  09154 Digestive system
   04970 Salivary secretion
    103541469
  09156 Nervous system
   04730 Long-term depression
    103541469
  09159 Environmental adaptation
   04713 Circadian entrainment
    103541469
Enzymes [BR:epz01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103541469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOB HNOBA Ntox34
Motif
Other DBs
NCBI-GeneID: 103541469
NCBI-ProteinID: XP_008506519
Position
Un
AA seq 298 aa AA seqDB search
LSYRDAEKNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQERFGEEFFNI
CFDENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPESTLMLHYF
HPHHIVGFAMLGMIKAAGKKIYRLDVEVEQIANEKLCSDGSNPGNCSCLTFLIKECENTN
ITKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPHMSVLQLGEGLRKQLRCETHKVLKF
GDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASSTENKDKVGGHELETGDGSWKSA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
cttagttatagggatgcagaaaagaatttccacaatatctctaacagatgctcctatgca
gaccattccaacaaagaggaaattgaagatgtctcaggaattcttcagtgtactgctaac
atacttggtttgaagtttgaggaaattcaagaaagatttggtgaggagttctttaatata
tgctttgatgagaatgagagagtccttcgagctgtaggtggcacattgcaggactttttt
aatggctttgatgctttgttggaacacattagaacttcttttggaaaacaggccactctg
gagtcaccatcattcctatgcaaagagctccctgaaagtactcttatgctgcactacttc
caccctcaccacattgtggggtttgcaatgctggggatgattaaggctgcaggaaagaag
atctatcgtctagatgtggaagtggaacagattgcaaatgagaaactgtgctctgatggt
tcaaacccaggcaactgtagctgtcttactttccttatcaaagaatgtgaaaatactaat
atcacgaagaaccttccacagggaacctcccaagttcctgcagacctcagaattagcatc
aacaccttctgcagagccttccctttccacttgatgtttgacccccacatgtcagtcctt
cagctgggggaaggcctaaggaagcagctgcggtgcgaaactcacaaagtgctcaagttt
ggggactgcttcgagatcgtttctccaaaagttaatgccacctttgaaagggtcctgttg
agactgtccaccccgtttgtgattaggaccaagcctgaggcttctagcactgaaaataaa
gacaaggtaggtggccatgaacttgagacgggtgatgggagctggaagagtgcataa

DBGET integrated database retrieval system