KEGG   Equus przewalskii (Przewalski's horse): 103541768Help
Entry
103541768         CDS       T04644                                 

Definition
(RefSeq) insulin receptor-like
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04015  Rap1 signaling pathway
epz04022  cGMP-PKG signaling pathway
epz04066  HIF-1 signaling pathway
epz04068  FoxO signaling pathway
epz04072  Phospholipase D signaling pathway
epz04150  mTOR signaling pathway
epz04151  PI3K-Akt signaling pathway
epz04152  AMPK signaling pathway
epz04211  Longevity regulating pathway
epz04213  Longevity regulating pathway - multiple species
epz04520  Adherens junction
epz04910  Insulin signaling pathway
epz04913  Ovarian steroidogenesis
epz04923  Regulation of lipolysis in adipocytes
epz04930  Type II diabetes mellitus
epz04931  Insulin resistance
epz04932  Non-alcoholic fatty liver disease (NAFLD)
epz04960  Aldosterone-regulated sodium reabsorption
Module
epz_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103541768
   04015 Rap1 signaling pathway
    103541768
   04010 MAPK signaling pathway
    103541768
   04066 HIF-1 signaling pathway
    103541768
   04068 FoxO signaling pathway
    103541768
   04072 Phospholipase D signaling pathway
    103541768
   04022 cGMP - PKG signaling pathway
    103541768
   04151 PI3K-Akt signaling pathway
    103541768
   04152 AMPK signaling pathway
    103541768
   04150 mTOR signaling pathway
    103541768
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103541768
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103541768
   04923 Regulation of lipolysis in adipocyte
    103541768
   04913 Ovarian Steroidogenesis
    103541768
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103541768
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103541768
   04213 Longevity regulating pathway - multiple species
    103541768
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103541768
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103541768
   04931 Insulin resistance
    103541768
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103541768
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:epz04090]
    103541768
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103541768
Protein kinases [BR:epz01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103541768
CD molecules [BR:epz04090]
 Proteins
  103541768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like B2 APH
Motif
Other DBs
NCBI-GeneID: 103541768
NCBI-ProteinID: XP_008506859
Position
Un
AA seq 314 aa AA seqDB search
IEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGR
PPPTLQEMVQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETD
YYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKF
VMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEE
NKAPESEELEMEFEDMENVPLDRSSHSQREEAGGRDAGSSLGLKRNYEEHIPYTHMNGGK
KNGRILTLPRSNPS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atcgagtttctcaacgaggcctcagtcatgaagggcttcacctgccatcacgtggtccgc
ctcctgggggtggtatcgaaaggccagccaacgctggtggtgatggagttgatggctcat
ggagacctgaagagctacctccgttccctgcggccggaggctgagaataaccctggccgc
cctccccctaccctgcaagagatggttcagatggcggcggagatcgccgacgggatggcg
tacctgaacgccaagaagtttgtgcaccgggacctggcagctcgaaactgcatggtcgcc
cacgattttaccgtcaaaatcggagactttggaatgaccagagacatctacgaaacggat
tactaccggaaaggaggcaaggggctgctccccgtgaggtggatggctcctgaatccctg
aaggacggggtctttactacttcttctgacatgtggtcctttggcgtggtcctttgggaa
atcaccagcttggcagaacagccttaccaaggcctgtctaatgagcaggtgttgaaattt
gtcatggatggagggtatctggatcaacccgacaattgtcccgagagagtcaccgacctg
atgcgtatgtgctggcagttcaaccccaagatgcggccgaccttcctggagattgtcgac
ctgctcaaggatgacctgcaccccagctttccagaagtttccttcttccacagcgaggag
aacaaggcccccgagagcgaggagctggagatggagtttgaggacatggagaacgtcccc
ctggatcggtcctcacattcccagagggaggaggccgggggccgggatgcagggtcctcg
ctgggtctaaagcggaactatgaggaacacatcccgtacactcacatgaacgggggcaag
aaaaatgggcggattctgactctgccgaggtcaaatccttcctaa

DBGET integrated database retrieval system