KEGG   Equus przewalskii (Przewalski's horse): 103542189Help
Entry
103542189         CDS       T04644                                 

Gene name
ESRRA
Definition
(RefSeq) estrogen related receptor alpha
  KO
K08552  estrogen-related receptor alpha
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epz03000]
    103542189 (ESRRA)
   03029 Mitochondrial biogenesis [BR:epz03029]
    103542189 (ESRRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:epz03310]
    103542189 (ESRRA)
Transcription factors [BR:epz03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    103542189 (ESRRA)
Mitochondrial biogenesis [BR:epz03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103542189 (ESRRA)
Nuclear receptors [BR:epz03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   103542189 (ESRRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 103542189
NCBI-ProteinID: XP_008507350
Position
Un
AA seq 422 aa AA seqDB search
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALASGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPAGPDGQLPAVATLCDLFDREIVVTIS
WAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAG
LGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLE
YEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAM
MD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccaggtggtgggcattgagcctctctacatcaaggcagagccagccagcccc
gacagcccaaagggttcctcggagaccgagaccgagccccccgtggccctggcctctggc
ccagctcccacccgctgcctcccaggccacaaggaggaggaggatggggagggcgctggg
cctggcgagcagggtggtgggaagctggtactcagctccctgcccaagcgcctctgcctg
gtctgtggggacgtggcctctggctaccactatggtgtggcatcctgtgaggcctgcaaa
gccttcttcaagaggaccatccaggggagcatcgagtacagctgtccggcctccaatgag
tgcgagatcaccaagcggagacgcaaggcctgccaggcctgtcgcttcaccaagtgcctg
cgggtgggcatgctcaaggagggggtacgtctggaccgtgtccggggtgggcgacagaag
tacaagcggcggccagaggtggacccgctgcccttccctggccccttccctgctggaccc
ctggcagtagctggaggccctcggaagacagccccagtgaacgcactggtgtcccacctg
ctggtggttgagcctgagaagctgtatgccatgcccgacccagcgggccctgatggacag
ctcccagccgtggctaccctctgtgacctctttgaccgagagatcgtggtcaccatcagc
tgggctaagagcatcccaggcttctcgtcactgtcgctatccgaccagatgtcagtcctg
cagagcgtgtggatggaggtactggtgttgggcgtggcccagcgctcactgccactgcag
gatgagctggcctttgctgaggacctggtcctggacgaagagggggcgcgagcagctggc
ctgggggaactgggggccgccctgctgcagctggtgcggcggctgcaggccctgcggctg
gagcgtgaggagtacgtcctgctgaaggccctggcccttgccaattcagactctgtacac
attgaagatgctgaggctgtggagcagctgcgggaagctttgcacgaggccctgctggag
tatgaggcgggccgggcgggccccggagggggtgctgagcggcggcgggcaggcaggctg
ctgctcacactaccgctccttcgccagacagcgggcaaagtgctggcccatttctatggg
gtgaagctggagggcaaggtgcccatgcacaagctgttcttggagatgctcgaggccatg
atggactga

DBGET integrated database retrieval system