KEGG   Equus przewalskii (Przewalski's horse): 103544231Help
Entry
103544231         CDS       T04644                                 

Gene name
PARP15
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 15
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103544231 (PARP15)
Enzymes [BR:epz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     103544231 (PARP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP Macro
Motif
Other DBs
NCBI-GeneID: 103544231
NCBI-ProteinID: XP_008509302
Position
Un
AA seq 365 aa AA seqDB search
MRMLARISALEELAELWKAEAEKEAGLDKLEKPKEAAWEGGAATQPHRDFIVTQGGFLMC
KIIMHVLEENDVRKTVSSVLEECEQRKYTSVSLPAIGTGNGGKNPVMVADDIISAVADFA
WKHSTPSLKTVKVVIFLTDLLKVFHDSMKKRAVSTSIFSKTAHNIPEQWTDMNQQPYCVV
KLQPGQSEYDTVKDKFCETCLSHEIEKIERIQNVFLWESYQVKKNHMDTKNGHTNNERQL
FHGTDADTVPYINQHGFNRSYAGKNATVFGKGTYFAVDASYSANDAYSRADSSGRKHIYV
VRVLTGVYTVGHAAIKSPPPKNPDNPTDLFDSVTDDTRHPKLFVVFSDHQAYPEYLITFR
KKNVS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgttagcaaggatctctgcactggaagagctagctgaactttggaaggcagaa
gcagagaaggaagctgggttggacaagctggaaaagcctaaggaggctgcctgggagggg
ggagcagctacacagcctcacagagattttatagttacacaaggtggattcctaatgtgc
aagataataatgcatgttcttgaggaaaatgatgtcaggaaaacggtctccagtgttctg
gaagaatgtgaacagaggaagtacacatctgtttcccttccagccatcggaacaggaaat
ggtggaaaaaaccctgtcatggttgctgatgatataatcagtgcagttgcagacttcgca
tggaaacattccactccatcattgaaaacagttaaagttgtcatctttctaactgatctg
ctaaaggtattccacgacagcatgaaaaaaagagcagtctccacatccatattctccaag
actgcacataatattcctgaacaatggactgacatgaatcagcagccatactgtgtggtc
aagctacaacccggacagtcagaatatgacaccgtgaaggacaagttctgtgagacttgt
ctttcccacgaaatagagaagattgagaggatacagaatgtatttctctgggagagctac
caggtaaagaaaaaccacatggacaccaagaatggccataccaataacgagagacaactc
ttccacggcacagatgcagacacagtgccgtacatcaatcagcacggctttaatcgcagt
tatgctgggaagaacgctacagtctttggaaaaggaacgtatttcgctgttgatgccagt
tattctgctaacgatgcatactccagagcagacagcagtgggagaaagcatatttacgtt
gtgcgagtacttacaggagtctacacagttggacacgcagcaataaaaagccctccacca
aagaaccctgacaaccctacggatctgtttgactctgtcacagatgatacacggcatcca
aagctatttgtggtattctctgatcatcaagcttacccagaatatctcataactttcaga
aaaaaaaatgtttcttaa

DBGET integrated database retrieval system