KEGG   Equus przewalskii (Przewalski's horse): 103544301
Entry
103544301         CDS       T04644                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103544301
Enzymes [BR:epz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     103544301
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 103544301
NCBI-ProteinID: XP_008509360
Position
Un
AA seq 160 aa
MLGSVAGVKADAAAEQLSRKKSHNGTQELSNSVAKNGTALELGPQPQGVPPAEDESPSGC
SSGRTPFPAFQMETYRLLSSVDFPRPGAGDLAGTVHPQLQGSPPPSSREGHLYERESTVS
PRSISEAAHSEKGIAFVQTEQLTFSMPTLPTLAPAATHHP
NT seq 483 nt   +upstreamnt  +downstreamnt
atgcttggaagtgtggctggagtgaaagctgatgcggcggcagaacagctgtccaggaag
aagagtcacaacggaactcaggaactcagcaactcagtggccaagaatggaacagccctg
gagctgggtccccagcctcagggcgtgccaccggccgaggatgagagccctagtggctgc
agctctggacgcacgccctttcctgccttccagatggaaacctacagactcctgagttcc
gtggacttcccccgcccgggggccggggacctggcaggcaccgtgcatcctcagctgcag
gggtctccgcctccttcctccagggagggccacctctatgagagggagtccaccgtgtcc
cccaggtccatcagcgaggctgcccactctgagaagggcattgccttcgtccagactgag
cagctcacattctccatgcccaccctgcccacgctggcccccgctgccacccaccatccc
taa

DBGET integrated database retrieval system