KEGG   Equus przewalskii (Przewalski's horse): 103544694Help
Entry
103544694         CDS       T04644                                 

Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase family member 3-like
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00230  Purine metabolism
epz00240  Pyrimidine metabolism
epz00500  Starch and sucrose metabolism
epz00740  Riboflavin metabolism
epz00760  Nicotinate and nicotinamide metabolism
epz00770  Pantothenate and CoA biosynthesis
epz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103544694
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103544694
   00240 Pyrimidine metabolism
    103544694
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    103544694
   00760 Nicotinate and nicotinamide metabolism
    103544694
   00770 Pantothenate and CoA biosynthesis
    103544694
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:epz04090]
    103544694
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:epz00537]
    103544694
Enzymes [BR:epz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     103544694
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     103544694
CD molecules [BR:epz04090]
 Proteins
  103544694
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:epz00537]
 Enzymes
  103544694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest
Motif
Other DBs
NCBI-GeneID: 103544694
NCBI-ProteinID: XP_008509728
Position
Un
AA seq 146 aa AA seqDB search
MLMEGLKQRNLDNCVNIILVADHGMDQTYCDKVEYMTDYFPQINFYMYEGPAPRIRAYND
CKYEDFETVNSEEIVRNLSCRKPDQHFKPYLTPDLPKRLHFAKNIRIDKVHLLVDEQWLA
VRSKSYSSCGGGTHGYDNEFKSMEVT
NT seq 437 nt NT seq  +upstreamnt  +downstreamnt
atgttgatggaaggcctgaagcagcggaatttagacaattgtgtcaatataatccttgtg
gctgaccatggaatggatcagacttattgtgacaaagtggaatatatgactgattatttt
ccccaaataaacttctacatgtatgaagggcctgccccccgcatcagggcttataatgac
tgtaagtatgaagactttgaaacagttaattctgaagaaattgttagaaacctcagttgc
cgaaaacctgatcagcatttcaaaccgtatttgactcctgatttgccaaaacgattacac
tttgccaaaaatatcagaatcgacaaagttcatcttttggtggatgaacagtggctggcc
gtgaggagtaaaagttattcatcctgtggaggaggcacccatggttacgacaatgagttt
aagagcatggaggtaac

DBGET integrated database retrieval system