KEGG   Equus przewalskii (Przewalski's horse): 103544963
Entry
103544963         CDS       T04644                                 
Name
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04014  Ras signaling pathway
epz04015  Rap1 signaling pathway
epz04020  Calcium signaling pathway
epz04022  cGMP-PKG signaling pathway
epz04024  cAMP signaling pathway
epz04070  Phosphatidylinositol signaling system
epz04114  Oocyte meiosis
epz04218  Cellular senescence
epz04261  Adrenergic signaling in cardiomyocytes
epz04270  Vascular smooth muscle contraction
epz04371  Apelin signaling pathway
epz04625  C-type lectin receptor signaling pathway
epz04713  Circadian entrainment
epz04720  Long-term potentiation
epz04722  Neurotrophin signaling pathway
epz04728  Dopaminergic synapse
epz04740  Olfactory transduction
epz04744  Phototransduction
epz04750  Inflammatory mediator regulation of TRP channels
epz04910  Insulin signaling pathway
epz04912  GnRH signaling pathway
epz04915  Estrogen signaling pathway
epz04916  Melanogenesis
epz04921  Oxytocin signaling pathway
epz04922  Glucagon signaling pathway
epz04924  Renin secretion
epz04925  Aldosterone synthesis and secretion
epz04970  Salivary secretion
epz04971  Gastric acid secretion
epz05010  Alzheimer disease
epz05012  Parkinson disease
epz05022  Pathways of neurodegeneration - multiple diseases
epz05031  Amphetamine addiction
epz05034  Alcoholism
epz05133  Pertussis
epz05152  Tuberculosis
epz05163  Human cytomegalovirus infection
epz05167  Kaposi sarcoma-associated herpesvirus infection
epz05170  Human immunodeficiency virus 1 infection
epz05200  Pathways in cancer
epz05214  Glioma
epz05417  Lipid and atherosclerosis
epz05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103544963
   04015 Rap1 signaling pathway
    103544963
   04371 Apelin signaling pathway
    103544963
   04020 Calcium signaling pathway
    103544963
   04070 Phosphatidylinositol signaling system
    103544963
   04024 cAMP signaling pathway
    103544963
   04022 cGMP-PKG signaling pathway
    103544963
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103544963
   04218 Cellular senescence
    103544963
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103544963
  09152 Endocrine system
   04910 Insulin signaling pathway
    103544963
   04922 Glucagon signaling pathway
    103544963
   04912 GnRH signaling pathway
    103544963
   04915 Estrogen signaling pathway
    103544963
   04921 Oxytocin signaling pathway
    103544963
   04916 Melanogenesis
    103544963
   04924 Renin secretion
    103544963
   04925 Aldosterone synthesis and secretion
    103544963
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103544963
   04270 Vascular smooth muscle contraction
    103544963
  09154 Digestive system
   04970 Salivary secretion
    103544963
   04971 Gastric acid secretion
    103544963
  09156 Nervous system
   04728 Dopaminergic synapse
    103544963
   04720 Long-term potentiation
    103544963
   04722 Neurotrophin signaling pathway
    103544963
  09157 Sensory system
   04744 Phototransduction
    103544963
   04740 Olfactory transduction
    103544963
   04750 Inflammatory mediator regulation of TRP channels
    103544963
  09159 Environmental adaptation
   04713 Circadian entrainment
    103544963
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103544963
  09162 Cancer: specific types
   05214 Glioma
    103544963
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103544963
   05163 Human cytomegalovirus infection
    103544963
   05167 Kaposi sarcoma-associated herpesvirus infection
    103544963
  09171 Infectious disease: bacterial
   05133 Pertussis
    103544963
   05152 Tuberculosis
    103544963
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103544963
   05012 Parkinson disease
    103544963
   05022 Pathways of neurodegeneration - multiple diseases
    103544963
  09165 Substance dependence
   05031 Amphetamine addiction
    103544963
   05034 Alcoholism
    103544963
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103544963
   05418 Fluid shear stress and atherosclerosis
    103544963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:epz01009]
    103544963
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epz04131]
    103544963
   03036 Chromosome and associated proteins [BR:epz03036]
    103544963
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103544963
Protein phosphatases and associated proteins [BR:epz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103544963
Membrane trafficking [BR:epz04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    103544963
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     103544963
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103544963
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF-hand_4 UPF0154 Poly_export PhageMin_Tail SPARC_Ca_bdg Caleosin
Other DBs
NCBI-GeneID: 103544963
NCBI-ProteinID: XP_008509952
Position
Un
AA seq 141 aa
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKWGDRQSLPCCLCPTVPGEERGEDREL
KPLSPNTQDGNGYISAAELRH
NT seq 423 nt   +upstreamnt  +downstreamnt
gctgaccagctgacagaggagcaaatcgcagagttcaaggaggccttctccctctttgac
aaggatggagacggcacgatcaccaccaaggagctggggacagtgatgagatccttagga
cagaaccccactgaagcagagctgcaggacatgatcaacgaggtggacgcggatgggaac
ggcaccatcgacttcccggagttcctgaccatgatggccaggaagatgaaggacacggac
agcgaggaggagatccgagaggccttccgtgtctttgacaagtggggtgaccgacagtcc
ctgccttgctgcctttgtcccactgtccccggggaagagcgaggtgaagaccgtgagctc
aagcctttgtcccccaacacccaggacggcaatggctacatcagcgccgcagagctgcgc
cac

DBGET integrated database retrieval system