KEGG   Equus przewalskii (Przewalski's horse): 103545709Help
Entry
103545709         CDS       T04644                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC19
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103545709
Enzymes [BR:epz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103545709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Orbi_VP7
Motif
Other DBs
NCBI-GeneID: 103545709
NCBI-ProteinID: XP_008510506
Position
Un
AA seq 134 aa AA seqDB search
MLPSLFAAFNVVLLLILSGLFFAFPCRWLVQNGEWVDPVVTGPLFILTFFSLVSLNVSDP
GILHQGSNELGPMMVPVVWVNHRAFRLQWCPRCCFHHPPRTYHCPWCNICVEVSTPFICP
PAPHPLPHLARGRD
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgagcctgttcgctgccttcaatgtcgtgctgctgctcatcctcagtggcctc
ttcttcgcattcccttgcagatggctggtccagaatggggagtgggtcgatcccgttgtc
acaggccccctcttcatcctgactttcttcagtctcgtttccctcaatgtgtcagaccct
ggcatcttgcatcaaggctccaacgaactgggccccatgatggtgcctgtggtgtgggtg
aaccacagggccttccgcctgcagtggtgcccaaggtgctgcttccaccacccgccccgg
acctaccactgcccatggtgcaacatttgtgtggaggtgagcacccctttcatctgcccc
cctgccccccaccctctgccccacctagcacgtggccgggactag

DBGET integrated database retrieval system