KEGG   Equus przewalskii (Przewalski's horse): 103546095
Entry
103546095         CDS       T04644                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:epz00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103546095 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:epz04040]
    103546095 (ASIC1)
Ion channels [BR:epz04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103546095 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 103546095
NCBI-ProteinID: XP_008510775
Position
Un
AA seq 559 aa
MPIQIFCSVSFSSREEAPGPLGDIWGPHQQQQRDNSESEEEEEEKEKEAARKEAREGDSP
MDLVAFANSCTLHGASHVFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVTYYLSYPHVT
LLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattttcctctagagaggaggccccggggccc
ttgggagatatttggggtccccaccagcagcagcagcgggacaactcagaatcagaagag
gaggaagaagagaaggaaaaggaggcagcaaggaaggaggccagagagggggattcaccc
atggacttggtggcctttgccaacagctgcaccctccacggcgccagccacgtcttcgtg
gaggggggtccaggcccaaggcaggccctgtgggcagtggcctttgtcctggcactgggt
gccttcttgtgccaggtaggggaccgcgttacttattacctcagctacccacatgtgact
ctgctagatgaggtggccaccacggagctggccttcccggcggtcaccctctgcaacacc
aatgccgtgcggctgtcccagctcagctaccccgacttgctctacctggcccccatgctg
gggctggacgaaagtgatgaccccggggtgcccctcgccccgccggggcctgaggccttc
tctggggagccctttaacctgcaccgcttctacaatcgctcctgccaccggctggaggac
atgctgctctactgctcctactgcggggggccctgcggccctcacaacttctcagtggtc
ttcacacggtatggaaagtgctacaccttcaactcgggccgagatgggcgtccacggctg
aagaccatgaagggtgggactggcaatgggctggagatcatgctggacatccagcaggac
gagtacctgcctgtctggggggaaactgacgagacgtccttcgaagcgggcatcaaagtg
cagatccacagtcaggatgaacctcccttcattgaccagctgggctttggcgtggcccca
gggttccagacctttgtgtcctgccaggagcagcggctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggactcggatttcttcgactcctacagcattaccgcc
tgccgcatcgactgtgagacgcgctacctggtggagaactgtaactgccgcatggtgcac
atgccaggagatgccccatactgcactccagagcagtacaaggagtgtgcggatcctgct
ctggacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccctgcaacctg
acccgctatggcaaggagctgtccatggtcaagatccccagcaaagcatcagctaagtac
ctggccaagaaattcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagaccattgagcagaagaaggcctatgagattgca
gggctcctcggtgacattgggggccagatggggctgttcatcggggccagcatcctcacg
gtgctggagctctttgactacgcctacgaggtcattaagcacaagctgtgcagacgaggg
aagtgccagaaggaggccaaaagaagcagcgcggacaaaggcgtagccctcagcctggat
gacgtcaaaagacataacccgtgtgagagtctccggggccatcctgccgggatgacgtac
gctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system