KEGG   Equus przewalskii (Przewalski's horse): 103549844Help
Entry
103549844         CDS       T04644                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00010  Glycolysis / Gluconeogenesis
epz00562  Inositol phosphate metabolism
epz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103549844 (MINPP1)
   00562 Inositol phosphate metabolism
    103549844 (MINPP1)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103549844 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103549844 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 103549844
NCBI-ProteinID: XP_008516655
Position
Un
AA seq 488 aa AA seqDB search
MMLRDPRRLLRVSVAPAAALAVAVLSSLSRCSLLEPEDCVISALSPYFGTKTRYEDVNPG
LLLDPEAPRRDPELLEETCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGPGDDKT
CAAGSHDLRAALAAWPLGYAEWMDGQLVEKGWQDMRQLALRLASLFPALFSFENYCRLQL
ITSSKHRCVDSGAAFLQGLWQHYHPGLPPPDIADMECGTPRINDKLMRFFDHCEKLLTEV
EGNATALYHVEAFKTGPEMQNIVKKVAATLQVPVGNLSADLIQVAFFTCSFDLAIKGVKS
PWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQP
VSSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVL
YHCKNAKNPKEEFQVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQNCHTSKECELPK
VNNTSDEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccgcgacccccgccgccttctcagggtgtctgtggcccccgcggcggccctg
gctgtggccgtgctgtcgtcgctctcgcgctgctccctcctggagccggaggactgcgtg
atctcggcgctcagcccctacttcggcaccaagactcgctacgaggatgtcaaccccggg
ctgctgctggaccccgaggcgccgcggcgggacccggagctgttggaggagacctgcacg
ccggtgcagctggtcgccctcatccgccatggcacccgctaccctacggccaaacagatc
cgcaagctgcgacagctgcacggcttgctgcaggcccgcgggcccggggatgacaagacc
tgcgctgccggcagtcacgacctgagggccgcgctggccgcctggccgctggggtacgcg
gaatggatggacgggcagctggtggagaaggggtggcaggacatgcgacagctggcgctg
cgcctcgcttcccttttcccggccctcttcagtttcgagaactactgccgcctgcagctc
atcaccagctccaagcatcgctgcgtggacagcggcgccgccttcctgcaggggctgtgg
cagcactaccaccctgggttgccgccgccggacatcgcagacatggagtgtgggactcca
agaattaatgataaactaatgaggttcttcgatcattgtgagaagcttttaactgaagtg
gaagggaatgctactgctctttatcatgtagaagccttcaaaactggaccagaaatgcag
aacattgtaaaaaaagttgcagctactttgcaagtaccagtcggcaatttaagtgcagat
ttaattcaggtagctttttttacctgttcatttgacctggcaattaaaggtgttaaatct
ccttggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctg
aagcaatattggaaaagaggatatgggtatactattaatagtcgatccagctgcaccctg
tttcaggatatctttcagcacttggacaaagcagttgaacagaaacaaaggtctcagcca
gtttcctccccagtcatccttcagtttggtcatgcagagacacttcttccactgctttct
ctcatgggctacttcaaagacaaggagcccctaacagcttacaattataaggaacaaatg
catcggaagttccgaagcggtcacattgtaccctatgcctcgaacctaatatttgtgctt
taccattgtaaaaatgctaagaatcctaaagaagaattccaagtgcagatgttattgaat
gaaaaggtgttaccattggctcactcacaagaaactgtttctttgtatgaggatctgaag
aaccactataaggacatccttcagaattgtcataccagtaaagaatgtgaattaccaaag
gtgaacaacacatctgatgagctgtaa

DBGET integrated database retrieval system