KEGG   Equus przewalskii (Przewalski's horse): 103549947Help
Entry
103549947         CDS       T04644                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00564  Glycerophospholipid metabolism
epz00565  Ether lipid metabolism
epz00590  Arachidonic acid metabolism
epz00591  Linoleic acid metabolism
epz00592  alpha-Linolenic acid metabolism
epz01100  Metabolic pathways
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04072  Phospholipase D signaling pathway
epz04217  Necroptosis
epz04270  Vascular smooth muscle contraction
epz04370  VEGF signaling pathway
epz04611  Platelet activation
epz04664  Fc epsilon RI signaling pathway
epz04666  Fc gamma R-mediated phagocytosis
epz04724  Glutamatergic synapse
epz04726  Serotonergic synapse
epz04730  Long-term depression
epz04750  Inflammatory mediator regulation of TRP channels
epz04912  GnRH signaling pathway
epz04913  Ovarian steroidogenesis
epz04921  Oxytocin signaling pathway
epz05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103549947 (PLA2G4E)
   00565 Ether lipid metabolism
    103549947 (PLA2G4E)
   00590 Arachidonic acid metabolism
    103549947 (PLA2G4E)
   00591 Linoleic acid metabolism
    103549947 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    103549947 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103549947 (PLA2G4E)
   04010 MAPK signaling pathway
    103549947 (PLA2G4E)
   04370 VEGF signaling pathway
    103549947 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    103549947 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103549947 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103549947 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    103549947 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    103549947 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103549947 (PLA2G4E)
   04913 Ovarian steroidogenesis
    103549947 (PLA2G4E)
   04921 Oxytocin signaling pathway
    103549947 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103549947 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    103549947 (PLA2G4E)
   04726 Serotonergic synapse
    103549947 (PLA2G4E)
   04730 Long-term depression
    103549947 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103549947 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103549947 (PLA2G4E)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103549947 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 103549947
NCBI-ProteinID: XP_008516832
Position
Un
AA seq 835 aa AA seqDB search
MLQRQMPAWVFHSLPDPSQTEDGRPSATCTLERGLFPCHLLTVRVIRMKNVRQADVVSQT
DCFVSLWLPTASHDRLRTRTISNCPNPEWNETFTFQIQSQVKNVLELSVCDEDTVTPDDH
LLTVLYDLTKLCFRKKTHVKFPLNPEGMEELEVEFLLEKSPDPPETLITNGVLVSRQVSC
LEVHAESRRRRKCGKQKDLLVTVTESFEHTQRILRCPEPCCPNPACFHYPKYFQSQIHVE
GPKSPWSCGLCCCCAHKKTGPICQPLDCLPDGQTVTLPVGENCELHMKSTPCPQTLDVRL
GFSLCSAELEFLQKRRLVVAEALKQVLQLEEDLQEDEVPLIAIMATGGGTRSMTAMYGHL
LGLQKLNILNCASYITGLSGATWTMATLYRDPDWSSKNLEPAIFEARRHVVKDKLPALFP
DQLSKFQEELRQRSQEGYKVTFTDFWGLLIEACLGDERNECKLSDQRAALCQGQNPLPIY
LTINVKDDVSNQDFREWCEFSPYEVGLQKYGAFIPTELFGSEFFMGRLMKRIPESRMCYM
LGLWSSIFSLNLLDAWNLSHTSEEFFYRWTRERVHDIEDEPLLPEIPKCDENILDTTVVI
PGSWLSNTFRSILTHRPFVSEFHNFLRGLQLHTDYLQNTEFSRWKDTVLDGFPNQLTASV
NHLCLLDTAFFVNSSYPPLLRPERKVDLIIHLNYCAGSQTKPMKQTCEYCTVQNIPFPKY
ELQEEEEKLKECYLMENLQEPDVPVVIFFPLINDTFQKYKAPGVERNPEELEQGQVDIYG
PKTPYATKELTYTEAAFDKLVKLSEYNILNNKDRLLQALRLAVEKKRRLKSQCPS
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaggcagatgcccgcctgggtcttccactccctgccagacccaagccaaaca
gaagatggcaggccgtcggccacctgcaccttggagagggggctgtttccatgccacctg
ctgacagtgagggtcatccggatgaaaaatgtgcgacaggctgatgtggtgagccagaca
gactgctttgtgagcctctggctgcccaccgcctctcatgacaggctgaggactaggacc
atctccaactgccccaacccagagtggaatgaaaccttcaccttccagatccagagccaa
gtgaagaacgtgctagagctgagcgtctgcgatgaagacacagtgacaccagatgaccat
ctcttgacagttctctatgacctcaccaagctctgcttccgaaagaaaacccacgtgaag
ttcccactcaacccagagggcatggaggagctagaggtggagttcctgctggagaaaagt
cctgatccacctgagaccctcatcaccaatggcgtgctggtgtctcgacaggtctcctgc
ctggaggtgcatgcagaatccaggaggcggagaaagtgtggcaaacagaaggacctcctg
gtgacagtgacggagtcctttgagcacacccagcgcatcttgcgctgcccggagccctgc
tgcccaaaccctgcctgcttccactaccccaagtacttccagtcccagattcacgtggag
gggcccaagagtccatggagctgtgggctttgctgctgctgtgcgcacaagaaaaccggc
cccatctgccagcccctcgactgcctccccgacggccagacggtgaccctgcctgtgggc
gagaactgtgaactacacatgaagtctacaccctgcccccagacactggacgtgcggctg
ggcttcagcctgtgctcggcagagctggagttcctccagaagcggaggctggtggtggct
gaggcgctgaagcaggtgttgcagctggaggaggacctgcaggaggacgaggtaccactg
atagccatcatggccaccgggggtggaacaagatccatgacggccatgtacggccacctg
ctggggctgcagaagctgaacatcctgaactgtgccagctacatcactggcttgtcaggg
gccacctggaccatggctaccttgtaccgtgacccagactggtcctccaaaaacctggag
cctgccatctttgaggcacggaggcacgtggtcaaggacaagttgcctgcactgttccca
gaccagctctccaaattccaggaggagctccggcagcgcagccaggaagggtacaaggtc
acctttacagacttctggggcttgctgatcgaggcctgtctgggggacgagagaaatgaa
tgcaaactgtcagaccagcgtgctgctttgtgccagggccagaaccccctgcccatctac
ctcaccatcaatgtcaaggatgatgtaagcaaccaggatttcagagagtggtgcgagttc
tccccctacgaggtgggcctgcagaaatacggggccttcatccccaccgagctctttggc
tccgagttcttcatgggacggctgatgaagaggatcccagagtcgcggatgtgctacatg
ctaggtttgtggagcagcatcttctccctgaacctgcttgatgcctggaatctgtcccac
acctcggaggagtttttctacaggtggacaagggagagagtgcacgacatcgaagacgag
ccactcctgcctgaaatccccaaatgtgatgaaaacatcctggacaccacggtggtgatc
ccagggtcgtggctgtccaacacattccgcagcatcctcacccatcggcccttcgtgtct
gagttccacaacttcctgcgggggctgcagctgcacaccgactacctccagaacacagag
ttctccaggtggaaagacaccgtgctggacggtttcccaaaccagctgacggcgtctgtg
aaccacctgtgcctgctggacaccgcgttcttcgtcaactccagctacccgcccctcctc
cggcctgagagaaaagtcgacctcatcatccatctcaactactgtgccggatcccagaca
aagcccatgaagcagacctgtgagtactgcaccgtgcagaacatccccttccccaagtat
gagctgcaggaggaggaggagaagctcaaggagtgctaccttatggagaacctgcaggaa
cctgatgtccccgtcgtgattttcttccctctcatcaacgacaccttccagaagtacaag
gccccaggtgtggagcgaaaccccgaggagctggagcagggccaggtcgacatttatggc
cccaaaactccctacgccaccaaggagctgacgtacacagaggccgccttcgacaagctg
gtgaagctctccgagtacaacatcctgaataacaaggacaggctccttcaggccttgcgg
ctggcagtggagaagaagagacgcctgaagagccagtgtccctcctaa

DBGET integrated database retrieval system