KEGG   Equus przewalskii (Przewalski's horse): 103550218Help
Entry
103550218         CDS       T04644                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00480  Glutathione metabolism
epz00590  Arachidonic acid metabolism
epz01100  Metabolic pathways
epz04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103550218 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103550218 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103550218 (GPX2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103550218 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103550218
NCBI-ProteinID: XP_008517195
Position
Un
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAISLDGEKIDFNTFRGRAVLIENVASLXGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNQHPVFAYLK
DKLPYPYDDPLSLMTDPKFIIWSPVCRSDVSWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacattgctaagtccttctacgaccttagtgctatcagcctggatggggagaag
atagatttcaatacattccgaggcagggcggtgctgattgagaatgtggcctcactctga
ggcacaactacccgggacttcacccagctcaacgagctgcagtgccgctttcccaggcgc
ctggtggttctcggcttcccgtgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgccctgggggtggattccagcccacctttacc
cttgtccaaaagtgtgaagtgaatggtcagaaccagcatcctgtcttcgcctacctgaag
gacaagctcccctacccttatgatgacccactttcccttatgaccgatcccaagttcatc
atttggagcccggtgtgccgctcagatgtgtcctggaactttgagaagttccttattggg
ccagagggggagcccttccgacgctacagccgcaccttccccaccatcaacattgagcct
gacatcaagcgcctcctcaaagttgccatatag

DBGET integrated database retrieval system