KEGG   Equus przewalskii (Przewalski's horse): 103551107Help
Entry
103551107         CDS       T04644                                 

Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00040  Pentose and glucuronate interconversions
epz01100  Metabolic pathways
Module
epz_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103551107
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     103551107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short NAD_binding_10 Epimerase KR ADH_zinc_N Shikimate_DH RmlD_sub_bind THF_DHG_CYH_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 103551107
NCBI-ProteinID: XP_008518646
Position
Un
AA seq 251 aa AA seqDB search
MELGLAGRRALVTGAGKGIGRSMVQALHAAGVQVVAVSRTRADLDSLVRECPGIEPVCVD
LGDWEATERALGGVGPVDLLVNNAAVALLQPFLEVTKEAIDTSFDINLRAVIQVSQIVAQ
GLIARGAQGSIVNVSSQASQRALTNHSVYCMPSLLTGSTKGAMDMLTKVMALELGPHKIR
VNAVNPTVVMTPMGRANWSDPQKGKPMLDRIPLGRFAEVENVVDTILFLLSDRSSMTTGC
TLPVDGGFLAT
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagctggggctcgcgggccgccgggcgctcgtgaccggagcgggcaaaggcatcggg
cgcagcatggtccaggcgctgcacgcggcgggtgtgcaggtggtggccgtgagccggacc
cgggccgacctggacagcctggtccgcgagtgccccgggatagagcccgtgtgcgtggac
ctgggtgactgggaggccactgagcgggcgctgggcggagtgggccctgtggacctgctg
gtgaacaacgccgccgtggcactgcttcagcccttcctggaagtcactaaggaggcgatt
gacacgtcgttcgacataaaccttcgggctgtcatccaggtgtctcagatcgtggcccag
ggcttaatagctcggggagcccaggggtccatcgtgaatgtctccagccaggcctcccag
cgcgcactgactaaccacagcgtctactgcatgccatctctcctcacaggctccaccaag
ggtgctatggacatgctgaccaaggtgatggctctggagcttgggccacacaagatccgg
gtgaatgcagtgaaccctacagtggtgatgacacccatgggccgggccaactggagtgac
ccccagaagggaaagcccatgctggaccgcattccacttgggaggtttgctgaggtggag
aatgtggtggacaccatcctcttcctgctgagtgaccggagcagcatgaccacgggctgc
accttgccagttgatgggggtttcctagccacctga

DBGET integrated database retrieval system