KEGG   Equus przewalskii (Przewalski's horse): 103551131Help
Entry
103551131         CDS       T04644                                 

Gene name
COPA
Definition
(RefSeq) coatomer protein complex subunit alpha
  KO
K05236  coatomer subunit alpha
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epz04131]
    103551131 (COPA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103551131 (COPA)
Membrane trafficking [BR:epz04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    103551131 (COPA)
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103551131 (COPA)
  Exosomal proteins of bladder cancer cells
   103551131 (COPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 103551131
NCBI-ProteinID: XP_008518688
Position
Un
AA seq 1233 aa AA seqDB search
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDAESITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHEHSCPLPLTAIVICNRKLEALCNIHENIRVK
SGAWDESGVFIYTTSNHIKYAVTTGDYGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLT
IDPTEFKFKLALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSL
ALECGNIEIALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITG
NLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEA
ESLKETFDPEKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGAL
AADIDIDTVGTEGWGEDAELQLDEDGFVEATEGLGDDVLGKGQEEGGGWDVEEDLELPPE
LDIPPGAAGGAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVTQ
FGPYKQLFLQTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQ
LCYQLTTVGKFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSMEIERK
KLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLEL
GPKPEVAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGAC
YSPEFKGQICRVTTVTEIGKDVIGLRISPLQFR
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaaattcgagaccaagagcgcgcgggttaaagggctcagttttcaccctaaa
agaccttggatcctgaccagtttacacaatggggtcatccagttatgggactatcggatg
tgtaccctcatcgacaagtttgatgaacatgatggtccagtacgaggcattgacttccat
aagcagcagccactgtttgtctctggaggagatgactataagattaaggtttggaattac
aagcttcggcgctgtctcttcacattgcttgggcacctagactacatccgcaccaccttt
tttcatcatgaatatccatggattctgagtgcctcagatgatcagaccatccgagtatgg
aactggcagtctaggacctgtgtctgtgtattaacggggcacaaccattatgtaatgtgt
gctcagttccacccctcagaagacctggttgtatcagccagcctggaccagactgtgcgc
gtttgggatatttctggtctaaggaaaaaaaacttgtcccctggtgcagtggagtcggat
gtgagaggaataactggggttgatctgtttggaactacagacgcagtggtgaagcatgtt
ttggagggtcatgatcgtggagtaaactgggctgccttccatcccactatgccccttatt
gtatctggggccgatgaccgtcaagtgaagatctggcgcatgaatgaatcaaaggcatgg
gaggttgatacctgtcggggccattataacaatgtgtcttgtgctgtcttccaccctcgc
caagagttgatcctcagcaattctgaggacaagagtatccgagtctgggatatgtctaag
cggactggggttcagaccttccgcagggaccatgatcgtttctgggtcctagctgcccac
cccaaccttaacctctttgcagcaggccatgatggtggcatgattgtgtttaaactggaa
cgggaacggccagcctatgctgttcatggcaatatgctgcattatgtcaaggaccgattc
ttacgtcagttggatttcaacagctccaaagatgtggctgtgatgcagttgcggagtggt
tccaagtttccagtgttcaatatgtcgtacaatccagcagaaaatgccgtcctactgtgt
acgagagccagcaatttagagaatagtacctatgacctgtacaccatccccaaggatgct
gactcccagaatcctgatgctcctgaagggaaacggtcctcaggcctgacagccgtttgg
gttgctcgaaatcgatttgctgtcttagatcggatgcattcgcttctgatcaagaatcta
aagaatgagattactaaaaaggtacaggtgcccaattgtgatgagatcttttacgctggc
actggcaacctcctgcttcgagacgcagaatccatcacactcttcgatgtacagcagaag
cggactctggcatctgtgaagatttccaaggtgaaatatgttatttggtcagcagacatg
tcccatgtagcactactggccaaacatgagcactcatgccctttgcctcttacagccatt
gtgatctgtaaccgcaaactggaggctctatgtaacattcatgagaacattcgtgtcaag
agtggggcctgggatgagagtggggtgtttatctataccacaagcaaccacatcaaatat
gccgtcaccacaggggactatgggatcatccgaactctggatttacccatctatgtcaca
cgagtgaagggcaacaatgtatattgcctagatagggagtgtcgtcctcgggtgctcacc
attgatcctactgagttcaagttcaagctggccctgatcaacagaaaatatgatgaggta
ctacacatggtgaggaatgccaaactagtaggccagtctatcattgcttatctccagaag
aagggctatcctgaggtggcactgcatttcgtcaaggatgagaaaactcgctttagtctg
gcactggagtgtgggaacattgagattgctctggaagcagccaaagcactggatgacaag
aactgctgggagaagctgggagaagtagctttgctacaggggaaccaccagattgtggaa
atgtgttatcagcgcaccaaaaactttgataaactttccttcctataccttattactggc
aacttagagaaacttcgcaagatgatgaagattgctgagatccgaaaggacatgagtggc
cattatcagaatgccctatacctgggagacgtgtcagagcgagtacggatcctgaagaac
tgtggccagaaatcactggcctatctcacagctgctacccatggcttagatgaagaagct
gagagcctgaaggagacatttgatccagagaaggagacaatcccagacattgaccctaat
gccaagctgctccagccacctgcacctatcatgccattggataccaattggcccttattg
actgtgtccaaagggttctttgaagggaccattgccagcaaggggaagggaggagcactg
gctgctgacattgacattgacactgttggtactgagggctggggagaggatgcagagctg
cagctggatgaagatggatttgtggaggctacagaaggtttgggagatgatgttcttggc
aagggacaggaagaaggaggtggctgggatgtagaagaagatctggagctccctcctgag
ctggatataccccctggggcagctggtggagctgaggatggattctttgtgcctcccacc
aagggaaccagtccaactcagatctggtgcaacaactctcagcttccagttgatcacatc
ctggcaggctcttttgaaacagccatgcggctccttcatgaccaggtgggggtcacccaa
tttggcccctacaaacagctgttcctacagacctatgcccgaggccgaaccacctatcag
gctctgccctgcctgccctccatgtatggctaccctaatcgcaattggaaggatgcaggg
ctgaagaatggagtacctgcagtgggcctgaagcttaatgacctcatccaacggttgcaa
ctgtgctaccagctcaccacagttggcaaatttgaggaggctgtggaaaaattccgttcc
attttacttagtgtgccacttcttgttgtggacaacaaacaggagattgcagaggcccag
cagctcatcaccatttgtcgtgagtacattgtgggtttgtccatggagatagaaaggaag
aagctgcccaaagagactctggaacagcagaagcgaatctgtgaaatggcagcctatttc
acccactcaaacctgcagcctgtgcacatgatcctggtgttgcgtacagctctcaacctg
ttcttcaagctcaagaactttaagacagctgccacctttgctcggcgcctgttggaactt
gggcccaagccagaggtggctcaacagacacgcaaaatcctgtcagcctgtgagaaaaac
cccacggatgcctatcagctcaattatgacatgcacaacccttttgacatctgtgctgca
tcttatcggcccatctaccgtggaaagccagtggagaaatgtccactcagtggggcctgc
tattccccggagttcaagggtcaaatctgcagagtcactacagtgacagagattggcaaa
gatgtgattggtttaagaatcagtcctctgcagtttcgttaa

DBGET integrated database retrieval system