KEGG   Equus przewalskii (Przewalski's horse): 103551358Help
Entry
103551358         CDS       T04644                                 

Gene name
PPIL6
Definition
(RefSeq) peptidylprolyl isomerase like 6
  KO
K12739  peptidyl-prolyl cis-trans isomerase-like 6 [EC:5.2.1.8]
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:epz03110]
    103551358 (PPIL6)
Enzymes [BR:epz01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103551358 (PPIL6)
Chaperones and folding catalysts [BR:epz03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    103551358 (PPIL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103551358
NCBI-ProteinID: XP_008519039
Position
Un
AA seq 320 aa AA seqDB search
VRRRGVPGGRAQSGRTRAYRGQRAGPGGRSTSRRATFNGGSERKKPSETGWEKKSLKNTY
PSKFEDPVIVPLQEFAWDQYLLEKKRELKNEVWEYSSYVMCFVNDQLLGDALDLQKWAHK
IWDIIDFRPPALYEALTVDFSTNFLRDTKHDFVFLDIAIDFYPIGRLIFELYCDVCPKTC
KNFQVLCTGIAGFSQSGFRLHYAGSIFHRIVRNGWIQGGDIVAGKGDGGESIYGPTFEDE
NFTIPHNKRGVLGMVNKGRHSNGSQFYITLQPTPYLDRKYVAFGQLIEGTEVLQQLELVP
TENERPTQQCIIIDSGDLYT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gttcggagacggggtgttccgggtgggcgggctcagtctggacggacccgagcataccgg
ggacaaagggcgggtccgggcgggcgttccacttcgagaagggcgacctttaatggggga
tccgagcgaaagaagccttcagaaactggctgggaaaaaaagagtctcaagaatacttat
ccatccaaattcgaagatcctgtaatagtgcctcttcaagaatttgcatgggatcaatat
ctactggagaaaaaaagggaactcaagaatgaagtctgggaatattcttcctatgtgatg
tgttttgttaatgatcagctcctgggtgatgcccttgaccttcagaaatgggcccacaag
atctgggatataattgatttcaggccgcctgcactttacgaggcacttactgtggatttt
tctactaacttcttaagagacaccaagcatgattttgtcttcctggacattgccattgat
ttttatccaattggaagactaatttttgagctgtactgtgacgtatgtcccaaaacatgt
aaaaattttcaggtcttatgtactggaatagcaggattttctcaaagtggcttcaggcta
cattatgcaggttcaatctttcatcgaatagtacgaaatggctggatacaaggaggagat
atagtagctggaaaaggagatggtggagagtccatttatggaccaacatttgaagatgaa
aactttacaattcctcataataaaaggggagttcttggaatggtcaacaaaggccgtcac
agcaatgggtcacaattctacatcacactacaaccaactccctatctagacagaaaatat
gtggcttttgggcaattgattgaaggaacagaagttcttcaacaactggaattggttcca
acagagaatgaaagaccaacacaacaatgtataattattgacagtggagatctgtatacc
tga

DBGET integrated database retrieval system