KEGG   Equus przewalskii (Przewalski's horse): 103552805Help
Entry
103552805         CDS       T04644                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04022  cGMP-PKG signaling pathway
epz04024  cAMP signaling pathway
epz04062  Chemokine signaling pathway
epz04071  Sphingolipid signaling pathway
epz04270  Vascular smooth muscle contraction
epz04350  TGF-beta signaling pathway
epz04360  Axon guidance
epz04510  Focal adhesion
epz04530  Tight junction
epz04611  Platelet activation
epz04670  Leukocyte transendothelial migration
epz04810  Regulation of actin cytoskeleton
epz04921  Oxytocin signaling pathway
epz05132  Salmonella infection
epz05135  Yersinia infection
epz05163  Human cytomegalovirus infection
epz05200  Pathways in cancer
epz05205  Proteoglycans in cancer
epz05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103552805 (ROCK1)
   04071 Sphingolipid signaling pathway
    103552805 (ROCK1)
   04024 cAMP signaling pathway
    103552805 (ROCK1)
   04022 cGMP-PKG signaling pathway
    103552805 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103552805 (ROCK1)
   04530 Tight junction
    103552805 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103552805 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103552805 (ROCK1)
   04670 Leukocyte transendothelial migration
    103552805 (ROCK1)
   04062 Chemokine signaling pathway
    103552805 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103552805 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103552805 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    103552805 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103552805 (ROCK1)
   05206 MicroRNAs in cancer
    103552805 (ROCK1)
   05205 Proteoglycans in cancer
    103552805 (ROCK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103552805 (ROCK1)
   05135 Yersinia infection
    103552805 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103552805 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103552805 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103552805 (ROCK1)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103552805 (ROCK1)
Protein kinases [BR:epz01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   103552805 (ROCK1)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103552805 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding HR1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 103552805
NCBI-ProteinID: XP_008521254
Position
Un
AA seq 1026 aa AA seqDB search
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSTNPNDNRTSSNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKV
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSVSQLESLNRELQERNRILENSKSQTD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLT
HSEKEKNNLEIDLNYKLKSLQQRLEQEINEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELGQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSMLTKDIELLRKENE
ELTDKMRKTEEEYKLKKEEEISNLKAAYEKNINTERTLKTQVYMLSAFSMCLYLSIMYSE
VNICSL
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatagacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatctgcgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatccgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaatagtccttgggtcgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacctaatgagcaactatgatgtgcctgagaagtgggcacgattctatactgca
gaagtagttcttgctttggatgcaatccattccatgggttttattcatagggatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacctgattat
atttcccctgaagtattgaaatctcaaggtggtgatggttattatggacgagagtgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctctggttggaacttacagtaagattatgaaccataaaaattcacttaccttccct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgaccga
gaggtgagattagggcgaaatggcgtagaagaaatcaaacgacatctcttctttaaaaat
gatcagtgggcttgggaaacactccgagacactgtagcgccagttgtacctgatttaagt
agtgacattgatacaagtaactttgatgacctggaagaagataaaggagatgaagaaaca
ttccctatacctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcaacaaatcctaatgataacagaactagctccaatgtg
gataaaagcttgcaggaaaatttgcaaaaaacaatttataagctagaagaacagctgcat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttcaaacataaaatta
gacaagataatgaaagaattggatgaagaggggaatcaaagaagaaatctagaatctaca
gtgtctcagattgagaaagagaaaatgttactacaacatagaattaatgagtaccaaaga
aaagcagaacaggaaaatgagaagaggagaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtcagtcagaattcgcagcttgctaatgagaaggtg
gcacaattacaaaagcagctagaagaagccaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcatactgagatgagcaagtcagtcagtcagctagagtcc
ctgaacagagaattgcaggagagaaatagaattttagagaattccaagtcacaaacggac
aaggattattaccagctgcaagctgtattggaagctgaacgaagagacagaggtcatgat
tctgagatgattggagaccttcaagcacggattacatctttacaagaggaggtgaaacat
ctcaaacataatcttgaaagagtggaaggagaaagaaaagaggctcaagacatgcttact
cattcagaaaaggaaaagaataatttagaaatagatttaaactacaaacttaaatcatta
caacaacgattagaacaggagataaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcagtctattgaagaggcaaagtctgttgcaatgtgtgagatggaaaaaaagctg
aaggaagaaagagaagctcgagagaaggctgaaaatagggttgttcagattgagaaacag
tgttccatgctagacgttgatctgaaacaatctcagcagaagcttgagcatttgactgaa
aataaagaaaggatggaggatgaagttaagaatctaactctgcaattggagcaggaatca
aataagcgactgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagagtttgagttaggtcagcttacaaaacagtatagaggaaatgaaggacagatgcgg
gagctacaagatcagcttgaagctgagcaatacttctcgacactttataaaacccaggta
aaggaacttaaggaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggcgcgagggcttctagaagagcagtattttgaattgacccaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
ctcgaagaaacgaatagcatgctaaccaaagatattgaattattaagaaaagaaaatgaa
gagttaactgataaaatgaggaagacagaggaagaatataaattgaagaaggaggaggag
atcagtaatcttaaggctgcctatgaaaagaatatcaatacagaacgaacccttaaaaca
caggtatacatgctctcagccttttccatgtgtttgtatctgagtatcatgtactcagaa
gttaatatttgctctttatga

DBGET integrated database retrieval system