KEGG   Equus przewalskii (Przewalski's horse): 103553119Help
Entry
103553119         CDS       T04644                                 

Gene name
ERLIN2
Definition
(RefSeq) ER lipid raft associated 2
  KO
K23341  erlin
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:epz04121]
    103553119 (ERLIN2)
Ubiquitin system [BR:epz04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    103553119 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 RapA_C DUF4346 POR_N
Motif
Other DBs
NCBI-GeneID: 103553119
NCBI-ProteinID: XP_008521772
Position
Un
AA seq 339 aa AA seqDB search
MAQLGAIVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEK
KISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD
IPNMFVDSAGGLGKQFEGLADKLGFGLEDEPLEADPEEN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgggagcaattgtggctgtggctaccagtttcttttgtgcatctctcttc
tcagctgtgcacaagatagaagagggacacattggggtgtattacagaggcggtgccctg
ctgacttccaccagcggccctggtttccatctcatgctccctttcatcacatcatataag
tctgtgcagaccaccctgcagacagacgaggtgaagaacgtaccttgtggaactagtggt
ggtgtgatgatctactttgacagaattgaagtggtgaacttcctggtccccaacgcagtg
tatgacatagtgaagaactatactgccgactacgacaaggccctcatcttcaacaagatc
caccacgagctgaaccagttctgcagtgtacacacgcttcaagaggtctacatcgagctc
tttgatcagattgatgaaaatctcaaactggctttgcaacaggacctgacctccatggcc
cctgggctggtcatccaagccgtgcgggtgaccaagcccaatatacccgaggcaatccgc
agaaactacgagttgatggaaagcgagaagacaaagctgctcattgcagcccagaaacag
aaggtggtggagaaggaagccgagacagagcggaagaaggccctcattgaggcagaaaaa
gtggctcaggttgcagaaatcacctatgggcagaaggtgatggagaaggagacagagaag
aagatttcagaaattgaagatgctgcatttctggcccgggagaaggcgaaggctgatgct
gagtgctacactgctatgaagatagccgaagcaaacaagctgaagctgacccctgagtat
ctgcagctgatgaagtacaaggccattgcttccaacagcaagatttactttggcaaggac
atccctaacatgttcgtggactctgcaggcggtctgggcaagcagtttgaggggctggct
gacaagctgggttttggcttagaagacgagcccttggaggcagaccctgaggagaattga

DBGET integrated database retrieval system