KEGG   Equus przewalskii (Przewalski's horse): 103554777Help
Entry
103554777         CDS       T04644                                 

Gene name
ACOD1, IRG1
Definition
(RefSeq) aconitate decarboxylase 1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    103554777 (ACOD1)
Enzymes [BR:epz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     103554777 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 103554777
NCBI-ProteinID: XP_008524243
Position
Un
AA seq 471 aa AA seqDB search
MALKSVTESFAKVIHGLSVGHLTDQVIQRSKRMILDTLGVGFLGTSTEVFHKVSEYSKIY
SSNMSSTVWGRPDLRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLMALSEALP
PSPKFSGLDLLLAFNVGIEVQGRLMHFSKEANDIPKRFHPPSVVGTLGSAAAASKILGLS
MTKCQEALAIAVSHAGAPMANAATQTKPLHIGNAARHGLEAVFLAMLGLQGNKRVLDLET
GFGAFYTNYSPKVLPNLDSHTWLLDQQDVAFKRFPAHLATHWVADAAVSVRKHLVTDRAL
LPVDHIERIVLRIPEVQYVNRPFPDSEHEARHSFQYVACTTLLDGGITVPSFYERQIHRP
QVRELLGKVELEHPQDNLPSFNTLYCEISVTLKDGATFTECADTFYGHWRKPLSQEDLQE
KFRANASRMLSCDTVERLIERVESLEDLEDCSVLIALLKGPSPPKMMSKSI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaagtctgtcacagaaagctttgccaaagtgattcatggcttgagcgtggga
cacctgacagatcaagttattcagaggagcaagaggatgattctggatacgctgggcgtt
gggttcctgggaaccagtacagaagtgtttcacaaagtcagcgaatatagtaaaatctac
agttccaatatgtccagcactgtttggggccggccagacctcaggctcccaccaacatat
gctgcttttgtcaacggtgtggctattcactcaatggatttcgatgacacctggcaccct
gccacccacccttccggagctgtccttcctgtcctcatggctttatcagaagccctgcct
ccaagtccaaagttttctggccttgacctgctactggctttcaatgttgggattgaagta
caaggtcgattaatgcatttctccaaggaagccaatgacataccaaagagattccatccc
ccctcagtggtaggaactttggggagtgctgctgctgcatccaagattttagggctcagc
atgacaaagtgccaagaggccctggctattgctgtgtctcatgctggagcacccatggca
aatgctgccactcagaccaagcctcttcatattggcaatgccgccaggcatgggcttgag
gctgtttttctggcaatgctgggtctccaaggaaacaagcgagtcttggatctggagaca
gggtttggggccttctacaccaactattcccctaaagtccttccaaacctggattcccac
acttggctgctggaccagcaggatgtggccttcaagcgtttccctgcacatttggccacc
cactgggtggcagacgcagctgtatctgtgagaaagcaccttgtaacagacagagccctg
cttcctgttgaccacattgagagaattgtgctcagaattccagaggtccagtatgtaaat
aggccctttccagactcggagcatgaagcccgtcactccttccagtatgtggcctgtacc
acactgctggatggtggcatcactgtgccatcattctatgaacgccagatccacaggccc
caggtgagggagctgcttggtaaggtggagctggagcaccctcaggacaacctgccaagc
ttcaacacactgtactgtgagataagtgtcactctcaaagatggagccaccttcacagag
tgcgcggataccttctacggtcactggaggaagccactgagtcaggaggacctgcaggag
aagttcagagccaatgcctccaggatgctgtcctgtgacacagttgaaagacttatagag
agagtggaaagcctggaagacctagaagactgttctgtattaatcgcacttctgaaaggc
ccttccccaccaaagatgatgtcaaaatccatctag

DBGET integrated database retrieval system