KEGG   Equus przewalskii (Przewalski's horse): 103555977Help
Entry
103555977         CDS       T04644                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04136  Autophagy - other
epz04140  Autophagy - animal
epz04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:epz00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103555977 (ATG16L1)
   04136 Autophagy - other
    103555977 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103555977 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epz04131]
    103555977 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:epz03029]
    103555977 (ATG16L1)
Membrane trafficking [BR:epz04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    103555977 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    103555977 (ATG16L1)
Mitochondrial biogenesis [BR:epz03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    103555977 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ZapB Fez1 KASH_CCD TolB_like HALZ
Motif
Other DBs
NCBI-GeneID: 103555977
NCBI-ProteinID: XP_008526044
Position
Un
AA seq 624 aa AA seqDB search
MSSGLRAADFPRWKRHIVEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAHKLQADK
HDTPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DREMQMNEAKIAECLQTISDLETECQELRSKLQDLEKANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETTDHAEETSPVRAISRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSSSDAA
RRRSVSSFPAPQDNVDAHPASSKEVRVPTTALCVFDAHDGEVNAVQFSPGSRLLATGGMD
RRVKLWEVSGDKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHT
LTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVM
SGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKIIDLRINAVR
QTFSAPGFKCGSDWTRVVFSPDGSYVAAGSADGSLYVWSVLSGKVEKVLSKQHGSSINAV
AWSPSGSHVVSVDKGSKAVLWSEY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgccgactttccccgctggaagcgccacatcgtggaggag
ctgaggcggcgggaccggctgcagaggcaggcgttcgaagagatcatcctgcagtataac
aagttgctggagaagtcagatcttcattcagtgctggcccataagctacaagctgacaag
catgacacaccaaacaggcatgagataagtcctggacatgacggtgcgtggaatgatagt
cagctacaggaaatggcccagctgaggattaaacaccaggaagaactgactgaattacac
aagaaacgtggagagttagctcagttggtgattgacctgaataaccaaatgcagcagaag
gaccgggagatgcagatgaatgaagcaaaaattgcagaatgcttgcagaccatctctgac
ctagagacagagtgccaagaactgcgcagtaagctgcaggaccttgagaaagccaatcag
accctgaaggatgaatatgatgccctgcagatcacttttacggccttggaggagaaactg
aggaaaaccactgaggagaaccaggagctggtcacccgatggatggccgagaaagcccag
gaagccaaccgcctaaatgcagagaatgagaaggattcaaggaggcgccaagcccggcta
cagaaagagcttgcagaagcagcaaaggaacctctaccagttgaacaggatgacgacatt
gaagtcatcgtggatgaaaccaccgatcatgcagaggagacctctcccgtgcgagccatc
agcagggcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttggtctgtccgagtctccccttttgggacatcactcttcttctgatgctgcc
aggaggcgctctgtctcttcctttccagcaccccaggataacgtggatgctcatcctgct
tctagtaaagaagtgagggtgccaacgactgcattgtgcgtctttgatgctcacgacggg
gaggtgaacgctgtgcagttcagtccaggttcccggctgctggccacaggaggcatggat
cggagggttaagctttgggaagtgtctggagacaaatgtgaattcaagggttccctctcc
ggcagcaacgcaggcattacaagcattgaatttgacagtgctggatcttacctcttagca
gcttcaaatgattttgcaagccgaatctggactgtggatgattatcggttgcggcacaca
ctcaccggacacagcggcaaagtgctgtcggccaagttcctgctggacaatgcgcgcatt
gtttctggaagtcatgaccggaccctcaaactctgggatctacgcagcaaagtctgcata
aagaccgtgtttgcaggatccagctgcaatgatatagtctgcacggagcagtgtgtaatg
agtggacattttgacaagaaaattcgtttctgggacatccgatcagagagtgttgtccga
gagatggagctgctggggaagatcactgccctggacttgaacccagaaaggactgagctc
ctcagctgctcccgtgacgacctgctgaaaattatcgacctgcggataaacgcggtcagg
cagacctttagcgcgcctgggttcaagtgcggctctgactggacgagagttgtgttcagc
cctgatggcagttacgtggcagcaggctcggccgacggctctctctacgtttggagtgtg
ctctcagggaaagtggagaaggtcctttcgaagcagcacggctcatccatcaatgcagtg
gcgtggtccccgtccggctcccacgtcgtcagtgtggacaaaggaagcaaagctgtgctg
tggtcggagtattga

DBGET integrated database retrieval system