KEGG   Equus przewalskii (Przewalski's horse): 103557298Help
Entry
103557298         CDS       T04644                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epz04131]
    103557298 (DOCK7)
Membrane trafficking [BR:epz04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103557298 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 103557298
NCBI-ProteinID: XP_008527937
Position
Un
AA seq 2194 aa AA seqDB search
MGSVGPSPGPPAPPRTPVWRLSSGGAPRGGGTSLWDLRLQETRDLIGYGRPGGRAVWAGP
QFCDLGPLWCWRQSRRTVAAEVRKQISGQYSGSPQLLKNLNIVGNISHHTAVPLTEAVDP
VDLEDYLITHPLPVDSGPLRDLIEFPPDDVEVVYSPRDCRTLASAVPEESEMDPHVRDCI
RSYTEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNNYQDEQDDLK
RRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRKSNRHKELFA
LHPSPDEEEPIERLSVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKIS
ENFYFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGE
CAEPYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLER
DSTEVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLTVTNFFKQEG
DRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPYYCLTPELLQVKLYPDS
RVRPTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQFMYGEDPSN
AMPVIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQ
KQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHK
GVFNVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLENELKSSISAL
NSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLEGNHD
QHGRNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSL
SNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQAQDR
SCNRMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVRESALQQAWFFFELMVK
SMVHHLYFNDKLDAPRKSRFPERFMDDIAALVSTIASDIVSRFQKDTEMVERLNTSLAFF
LNDLLSVMDRGFVFVLIKTCYKQVSSKLYSLPNPSVLVSLRLDFLRIICSHEHYVTLNLP
CSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVI
LDPDAEGLFGLHKKVINMVHNLLSSHDSDPRFSDPQIKARVAMLYLPLIGIIMETVPQLY
DFTETHNQRGRPICIATDDYESESGSMISQTVAMAIAGTSVPQLTRPGSFLLTSTSGRQH
TTFSAESSRSLLICLLWVLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKV
FERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRK
DMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGG
VLKVLLHSMACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSIN
TIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTY
AEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDL
RLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVL
EESAVSDDVVSPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHE
ANRDAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEFVYKEPA
ITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMK
DRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKE
EIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLS
EIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQ
PLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL
NT seq 6585 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgtggggccgtccccggggccgcctgcccctccccgcaccccggtctggagg
ctgagctccggcggggctccccgcggcggagggacgtctttgtgggatctccgactgcag
gagacacgagacctgattggatatggaaggccaggaggacgggcagtctgggctggtccc
cagttttgtgacctgggccccctgtggtgctggaggcagtctcggagaactgtggctgct
gaagttaggaagcagatctctggacaatacagtggttctccccaactgctcaaaaacctc
aacattgttggcaatatatcccatcataccgcagtgccccttactgaagcagtggatcca
gtggatttggaagattacctcattactcatcctttacctgtggactctgggcctttaagg
gatttgattgaattccctccagatgatgttgaagttgtttatagtcctagggactgtaga
acccttgcttcagctgtacctgaagaaagtgaaatggatccacatgttagagattgtata
agaagttatacagaagactgggcaattgtgatcagaaaatatcataaactgggaacagga
tttaatcccaatacattagataaacagaaagagaggcaaaaaggtttgccaaaacaggtc
tttgaatctgatgaagcgccagatggcaacaactaccaggatgagcaagatgatcttaaa
agacgttcaatgtccatagatgatactccaagggggagctgggcctgcagtatttttgac
ttgaaaaattcacttcccgatgctctgcttcccaatttacttgatcgaactccaaatgaa
gaaatagaccgtcagaatgatgaccaaaggaagtcaaaccgtcacaaggaactcttcgct
ttgcatccgtcaccagatgaggaagaacccatagaacgacttagtgttcctgatgtaccc
aaagaacattttggtcaaagacttcttgtaaaatgtttatcactcaagtttgagattgaa
atcgaacccatttttgcaagtttggctttatatgatgtcaaggaaaagaaaaagatttca
gaaaacttttattttgaccttaattctgagcagatgaaaggattgttacgtccacatgta
ccacctgctgccattactaccctggcaagatcagctattttttctatcacttatccttcc
caagatgtttttcttgtaataaagctagaaaaagtcctacagcagggagacattggagaa
tgtgctgaaccatatatgattttcaaagaagcagatgccaccaagaataaggaaaaattg
gagaagctgaaaagtcaagccgatcagttttgccaaagacttgggaaatatcgcatgcct
tttgcttggaccgcaatccatttaatgaatattgttagtagtgctgggagtttggaaaga
gattctacggaggtagaaataagcactggagaacgaaaagggtcttggtcagaaaggagg
aattctagtattgttggcagacgatcactggaaaggacaacaagtggagatgatgcttgt
aacttgaccagctttcgacctgctactctcacagtgacaaatttttttaagcaggaagga
gaccgcctaagtgatgaagatctgtacaaattccttgctgatatgagaaggccatcttct
gttttacgacgactaagacctattacagctcagctgaagatagacatttctcctgcacct
gaaaatccctattattgcctaaccccagaactgcttcaggtgaagctgtaccctgacagt
agagttagaccaactagagaaattttggaatttcctgccagggatgtctatgttccaaat
acgacttacagaaatcttctctacatataccctcagagtctcaattttgccaaccgtcaa
ggttctgccagaaatataacagtgaaagtccagtttatgtatggggaggatccaagtaat
gccatgccggtaatctttggtaaatctagctgttcagaattttcaaaggaagcctataca
gccgtagtatatcataacaggtctcctgattttcatgaagaaatcaaggttaaacttcct
gctactttaactgaccatcatcacttgctttttactttttatcatgttagttgtcaacaa
aaacaaaatactcctcttgaaactcctgttggatatacatggataccaatgcttcagaat
ggacgattaaagactgggcagttttgtctaccagtctcactggaaaaaccaccacaggct
tattctgtactgtctcctgaggttcctctacctggcatgaaatgggtagataatcacaaa
ggtgtttttaatgttgaagttgttgccgtttcatctatccacacacaagatccttatctt
gacaagttttttgctctggtcaatgctctggatgagcacatgttcccggtccgaattgga
gacatgcgaatcatggaaaataacttagaaaatgaattgaagagcagtatttcagcattg
aattcatctcagttggaaccagtagtccgatttcttcatcttctacttgataaattaata
cttttagttgttagacctcctgtcattgctggccaaatagttaatctaggtcaagcatct
tttgaagccatggcatcaattataaatcggcttcacaaaaacttggaaggaaatcatgac
cagcatggcaggaacagccttcttgcatcatatatctattatgttttccgcctaccaaat
acttacccaaattcaccatcaccaggtcctgggggtttgggaggatcagtgcattatgcc
acaatggctagatctgctgtgagacctgcaagccttaatttaaatcgttctcgaagcctg
agtaatagtaatccagatatatctgggactcccacatcgccagatgatgaagtacggtca
atcattggcagtaagggtttagatcgctccaattcctgggttaacactggtggtccaaaa
gctgccccatggggatccaaccccagtccaagtgcagagtcaacacaggctcaggatcga
agttgtaaccgtatgtcttcgcacacagagacttcaagtttcttacaaacattaacggga
cgcttaccaactaaaaagctttttcacgaagagctggccttgcagtgggttgtttgcagt
ggcagtgttcgggaatcagctttgcaacaagcttggttcttttttgagttaatggtaaag
agcatggtgcaccatttatactttaatgataaacttgatgcaccaaggaaaagtcgtttt
ccagaacgtttcatggatgacattgctgctctagtcagcacaattgctagtgatatagtt
tcacgatttcagaaggacacagaaatggttgagagacttaacacaagccttgcattcttt
ctcaatgatctattgtctgttatggatagagggtttgtctttgtccttataaagacctgc
tataaacaggtgtcttcaaagctttattcattaccaaatccaagtgtcctggtgtccttg
aggctggattttctgcgaatcatctgcagccatgagcattatgttacattaaacttaccc
tgcagcctgcttactccacctgcatcaccatcaccttctgtttcttctgcaacctcgcag
agttctgggttttccacaaatgtacaagaccagaagattgcaaatatgtttgaattgtct
gtgcctttccgccaacagcattatttggcaggacttgtgttaacagagctggctgtcatt
ttagaccctgatgctgaaggactgtttggattgcacaagaaagtcatcaatatggtacac
aatttactatccagtcatgactcagacccacggttctctgacccccagataaaggctcgg
gtggccatgttgtatctccctcttattggcattatcatggaaactgttcctcagctgtat
gattttacagaaactcacaatcaaagaggaagaccaatttgtatagccactgatgattat
gaaagtgagagcggaagcatgatcagccagacagttgccatggcaattgcaggaacatct
gttcctcagctaacaaggcccggcagcttcctcctcacgtcaacgagcggcaggcaacac
accaccttttcagcagaatcaagtcggagccttttgatttgtctcctttgggttctcaag
aatgcagatgaaacagttctacaaaagtggtttacagatctctcagttttgcagctgaac
cggctcttagatctgctttatctctgtgtttcttgctttgagtacaaaggaaagaaagtg
tttgaaagaatgaatagtttgacctttaagaaatcaaaagatatgagagcaaagcttgaa
gaagctattcttgggagcataggcgctaggcaagaaatggtgcgccgaagccgaggacag
cttgagagaagcccatctggaagtgcctttggaagtcaagaaaatctgaggtggaggaag
gatatgacccattggcgtcaaaacactgagaagcttgacaagtcaagagcagagattgaa
catgaagcactgattgatggaaatctggctactgaagccaacctaatcattttggataca
ttagaaattgttgtccagactgtttctgtgacagaatccaaagagagcatcctcggtggg
gtgctgaaagtgctcctgcacagcatggcctgtaaccaaagtgcagtttatctacagcac
tgttttgctacccagagagccctcgtttcaaagttccctgaactcttgtttgaagaagag
acagagcagtgtgctgatttgtgcctccggctcctccgacactgtagcagtagcatcaat
acaatacggtcacatgctagcgcctccctctacctccttatgagacagaactttgagatt
gggaacaacttcgccagggttaaaatgcaggtaacaatgtcactgtcttcgttggtgggc
acatctcagaattttaatgaagaattcttaagacgttctctgaagactatattgacatat
gctgaagaagatctggaattgagggaaacgacgtttcctgatcaggtccaagatttggtt
ttcaatctccatatgatcctttctgatactgttaaaatgaaggaacaccaggaggatcct
gaaatgttgattgatctaatgtacagaattgccaagggctaccagacctctccagatctg
cggttgacctggttgcagaacatggctggcaaacattcagaacgcagcaatcatgctgag
gctgcgcagtgcctggtccactcagcagcacttgttgctgaatatttgagcatgctagag
gaccggaaatatcttcctgtaggatgcgtaacatttcagaatatttcatctaatgtttta
gaagaatctgcagtctcagatgatgtggtatctccagatgaagaaggtatctgctctgga
aagtactttactgagtcaggacttgtgggattactggaacaagcggctgcctctttctct
atggctggcatgtatgaagcagttaacgaggtttacaaagtacttattcctattcatgaa
gctaatcgggatgcaaagaaactatccacgattcacggtaaacttcaagaagcattcagc
aaaattgttcatcagagtactggctgggagcggatgtttggcacctattttcgtgttggt
ttttatggaaccaagttcggggatttggatgaacaggaatttgtttacaaggagcctgca
ataaccaaacttgcagagatatctcacagattggagggattttatggagaaagatttgga
gaggatgtggttgaagtaatcaaggattctaatcctgtagacaagtgtaaattagatcct
aacaaggcgtatattcaaatcacctacgtggaaccatactttgacacatatgagatgaag
gacagaatcacatattttgacaaaaattataatcttcggcgttttatgtactgtaccccc
ttcactttagatgggcgtgcccatggggaactacatgaacaattcaagcggaagaccatt
ctgactacttctcatgcctttccttatattaaaacaagggtcaatgtcactcacaaagag
gagatcattttaacaccaattgaagttgctattgaagacatgcagaaaaagacacaggag
ttggcattcgcaacacatcaggatccagcagatcccaaaatgcttcaaatggtactccag
gggtctgtaggcacaacagtgaatcaggggcctttggaagttgcccaggttttcttgtct
gaaatacccagtgacccaaaactcttcagacatcataataaactgcgactctgcttcaaa
gattttactaaaaggtgtgaggatgccttaagaaaaaataagagcttaattgggccagat
caaaaggagtatcaaagggaactggagagaaactatcatcgccttaaagaggccctgcag
cctctgataaacagaaagatccctcagttatacaaggcagtattacctgtcacctgtcac
agagattccttcagtcgaatgagcctgcgcaaaatggatctctaa

DBGET integrated database retrieval system