KEGG   Equus przewalskii (Przewalski's horse): 103558736Help
Entry
103558736         CDS       T04644                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00350  Tyrosine metabolism
epz00360  Phenylalanine metabolism
epz00380  Tryptophan metabolism
epz01100  Metabolic pathways
epz04726  Serotonergic synapse
epz04728  Dopaminergic synapse
epz05030  Cocaine addiction
epz05031  Amphetamine addiction
epz05034  Alcoholism
Module
epz_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
epz_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103558736
   00360 Phenylalanine metabolism
    103558736
   00380 Tryptophan metabolism
    103558736
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    103558736
   04726 Serotonergic synapse
    103558736
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    103558736
   05031 Amphetamine addiction
    103558736
   05034 Alcoholism
    103558736
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103558736
Enzymes [BR:epz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103558736
    4.1.1.105  L-tryptophan decarboxylase
     103558736
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103558736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 103558736
NCBI-ProteinID: XP_008530139
Position
Un
AA seq 263 aa AA seqDB search
MEVTGLTKKWELKGGLFFTPQVVATLGTTSCCSFDNLLEVGPICIKEDVWLHIDAAYAGS
AFICPEFRPLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFKLDPVYLKHSH
QDSGLITDYRHWQLPLGRRFRSLKMWFVFRMYGIKGLQAYIRKHVQLSHEFESLVQQDPR
FEICAEVTLGLVCFRLKGSNKLTKALLERINNAKKIHLVPCHLRDKFVLRFAICSRTVES
AHVQLAWEHIRGLATELLKAEKE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaggttacgggactgactaagaagtgggagctgaaaggaggtctgtttttcactcca
caggtggtggctacactggggaccacatcttgctgctcgtttgataatctcttagaagtg
ggtcctatctgtatcaaggaggacgtgtggctgcacattgatgctgcctatgcaggcagc
gccttcatctgccctgaattccggcctcttctcaatggtgtagagtttgcggattcattt
aactttaatcctcacaaatggcttttggtgaattttgactgctctgccatgtgggtgaaa
aagagaacagacctaacaggagcctttaaactggaccctgtctacctgaagcacagccac
caggattcagggcttatcactgactacaggcactggcagttaccactgggtcgaagattc
cgctctttgaagatgtggtttgtttttaggatgtatggaatcaagggactgcaagcctat
atccgcaagcacgtccagctgtctcacgagtttgagtctttggtgcagcaggatccccgc
tttgaaatctgtgcagaagtcactctggggctggtctgttttcggctaaagggttccaac
aaactgaccaaagctcttctggaaagaataaacaatgccaaaaagatccacttggttccc
tgtcacctcagagacaagttcgtgctgcgttttgccatctgctctcgcacggtggaatct
gcccacgtgcagctggcctgggagcacatcagagggctggcaaccgaactgctgaaagca
gagaaggaataa

DBGET integrated database retrieval system