KEGG   Equus przewalskii (Przewalski's horse): 103559075Help
Entry
103559075         CDS       T04644                                 

Gene name
IDE
Definition
(RefSeq) insulin degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:epz00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103559075 (IDE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:epz01002]
    103559075 (IDE)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     103559075 (IDE)
Peptidases and inhibitors [BR:epz01002]
 Metallo peptidases
  Family M16: pitrilysin family
   103559075 (IDE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 103559075
NCBI-ProteinID: XP_008530644
Position
Un
AA seq 834 aa AA seqDB search
MDSVDGSANTNASACSSAPPYLGILALTKYFSSLSGNKYTLETRPNQEGIDVRQELLKFH
STYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKNVPLPEFPEHPFQEEHLKQLYKIV
PIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLVGGQKE
GARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFK
DKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAVVSKSF
EGKTDCTEEWYGTQYRQEAIPDEVIKKWQNADLNGKFKLPTKNEFIPTNFEILSLEKEAT
PYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLN
EYAYAAELAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEA
YMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIPQLLSRLHI
EALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQLPDRGWFVYQQRNEV
HNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQG
LRFIIQSEKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECA
KYWGEIISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDS
CPVVGEFPCQNDINLSQAPGLPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgtggatggctctgccaataccaatgccagtgcctgttcctctgcacctccc
tacctggggatcctggcgctgacaaaatatttttcctctctttcaggtaacaaatatact
ctagagaccagaccaaaccaagaaggcattgatgtaagacaggagctattgaaattccat
tctacttattattcatccaacttaatggctatttgtgttttaggtcgagaatctttagat
gacctgactgatctggtggtaaagttattttctgaagtagagaacaaaaatgtcccattg
ccagaatttcctgaacaccctttccaagaagaacatcttaaacaactttacaaaatagta
cccattaaggatattaggaatctttatgtgacatttcccatacctgaccttcagaaatac
tacaaatcaaatcctggtcattatcttggtcatctcattgggcacgaaggtcctgggagt
ctgttatcagaacttaaatcaaagggctgggtaaatactcttgttggtggacagaaggaa
ggagcccgaggttttatgttttttatcattaatgtggacttgactgaggaaggattatta
cacgttgaagatataattttgcacatgtttcaatacattcagaagttacgtgcagaagga
cctcaagaatgggttttccaagagtgcaaggacttgaatgctgtcgcttttaggtttaaa
gataaagagaggccaaggggctatacttctaagattgcaggaatattgcattattatccc
ctagaagaagtcctcacagctgagtatttactggaagaatttagacccgatttaatagag
atggttctcgataaactcagaccagaaaatgtccgggttgcagtagtttccaaatctttt
gagggaaaaacggattgcacggaagagtggtatggaacccagtacagacaagaagctata
ccagatgaggtcattaagaaatggcaaaatgctgacctgaatgggaaatttaaacttcca
acaaagaatgaatttatccctacgaattttgagattttatcattagaaaaagaagcgaca
ccatacccttctcttattaaggatacagctatgagcaaactctggttcaaacaagatgat
aagtttttcttaccgaaggcttgtctcaactttgaatttttcagcccatttgcttatgtg
gaccccttgcactgtaacatggcctatttgtaccttgagctcctcaaagactcactcaac
gagtatgcatatgcagcagagctagcaggcttgagctatgacctccaaaataccatctat
gggatgtatctctcggtgaaaggttacaatgacaagcagccaattttgctaaagaagatt
attgagaaaatggctacctttgagattgatgaaaaaagatttgaaattatcaaagaagca
tatatgcgatctctgaacaatttccgagctgagcagcctcaccagcacgccatgtactac
ctccgcttgctgatgactgaagtggcctggacgaaagatgaattaaaggaagccctggat
gatgtcacccttcctcgccttaaggccttcatacctcagctcctgtcacggctgcacatt
gaagcccttctccatggaaacataacaaagcaggctgcattaggaattatgcagatggtt
gaagatactcttattgaacatgctcatacgaaacctctccttccaagtcagctcgttcgg
tatagagaagttcagctccctgacagaggatggtttgtttaccagcagaggaatgaagtt
cacaataactgtggcatcgagatctactaccaaacagacatgcagagcacctcggagaat
atgtttctagagctcttctgtcagatcatctcagagccttgcttcaacactctgcgcacc
aaggagcagctgggctatattgtcttcagcgggccacggcgagccaacggcatccagggt
ttacggtttattatccagtcagaaaagccgcctcactacctggaaagccgagtggaagct
ttcttaatcaccatggaaaagtccatagaggacatgacagaagaggccttccagaaacac
attcaggcgttagcgattcgtcgactagacaaaccaaagaaactctctgcagagtgtgct
aaatattggggggaaatcatctcccagcaatacaattttgacagagataatacagaagtt
gcatatttaaagacacttaccaaggaagatatcattaagttctataaggaaatgttggca
gtagatgccccaaggagacataaggtatccgtccatgttcttgcgagagaaatggattct
tgtcctgtggttggagagttcccatgtcagaatgatattaatttgtcacaagcaccaggc
ttgccacaacctgaagtgattcagaacatgaccgagttcaagcgtggtttgccactgttt
ccccttgtgaaaccgcacattaacttcatggctgcaaagctctga

DBGET integrated database retrieval system