KEGG   Equus przewalskii (Przewalski's horse): 103559145
Entry
103559145         CDS       T04644                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00100  Steroid biosynthesis
epz01100  Metabolic pathways
Module
epz_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103559145 (TM7SF2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103559145 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103559145
NCBI-ProteinID: XP_008530757
Position
Un
AA seq 415 aa
MASPQGSLEFGGPLGAAALMLVLPATMFHLLLVARSGPARLLGPPPYLPGPEALWSPRAL
QLVLAWLGLQAALYLLPARKVAEGQELKNKSRLRYPINGFQALVVTTLLVGLGVSAGLPL
DALPEMLLPLAFAATLTAFVFSLLLYLKALVAPASALAPGGNSGNPIYDFFLGRELNPRI
SSFDFKYFCELRPGLMAWVLINLALLLKEAELRGSPSLAMWLVNGFQLLYVADALWHEEA
VLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGLPMASVICLINAIGYYV
FRGANSQKNTFRKNPSDPRVADLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSL
PCGVSHLLPYFYLLYFTALLVHREARDEQQCLQKYGLAWREYCKRVPYRILPYVY
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcttctcctcagggttccctggaattcgggggacctctgggcgctgcggcgctgatg
ctggtgctccctgccaccatgttccacctgctgctggtggcccgctcgggcccagcgcgc
ctcctgggcccacccccctacctgcccggccccgaggcgctgtggagcccgcgggcgctg
cagctcgtgctcgcctggctcggcctgcaggcggcgctctacctactgccggcgcgcaag
gtggccgaggggcaggagttgaagaacaagagtcgcctgcgctaccctattaacggcttc
caggccctggtggtgacaaccctgttggtgggcctgggggtgtcggctgggctgcccctg
gacgcgctcccggaaatgctcctgcccttggcgtttgcggccaccctcaccgccttcgtc
ttcagcctccttctctatctgaaggctctggtagcccctgcctccgccctggcacctggg
ggcaactcaggcaaccccatttacgactttttcctgggacgggagctcaacccgcgcatc
tcttcctttgatttcaaatatttctgcgaacttcggcctggcctcatggcctgggtcctc
atcaacctggccctgctcctgaaggaagcagaacttcggggaagtccgtcactggccatg
tggctggtcaatggcttccagctcctctacgtggctgatgccctctggcatgaggaggct
gtcctcaccaccatggacatcacacacgacgggtttggcttcatgctggcctttggggac
ctagcctgggtacccttcacctacagccttcaggcccagttcctgctgtaccacccgcag
ccgctggggttgccgatggcctcagtcatctgcctcatcaatgctattggctactacgtc
ttccgtggagccaactcccagaaaaacaccttccgaaagaatccttctgaccccagagtg
gctgaccttgaaaccatacctacagctacggggcgacagctgctggtgtctgggtggtgg
ggaatggtccgccatcccaactaccttggagacctcatcatggctctggcctggtccttg
ccctgcggggtgtcccacctgctgccctacttctacctcctctatttcactgcgctgctg
gtgcaccgtgaggcccgggatgagcagcagtgcctgcagaagtacggcctggcctggcgg
gaatactgcaagcgcgtgccttaccgaatcctgccctatgtctactga

DBGET integrated database retrieval system