KEGG   Equus przewalskii (Przewalski's horse): 103559581
Entry
103559581         CDS       T04644                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:epz01009]
    103559581 (AKAP5)
Protein phosphatases and associated proteins [BR:epz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103559581 (AKAP5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 103559581
NCBI-ProteinID: XP_008531462
Position
Un
AA seq 429 aa
METTVSEIQVESKDEKRPAEVSPQDKRQEEEASMLCFKRRKKPAKAVKPRVGSDAAGVAR
KCPLEAGASDQPQPQVGAWASIKRLVTRRKRSDSSKQQKLFEAKVQPEINAEDADPSKKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDCSIRVQGEAESLDTKTLTQSDDQATKTKVTQ
DVSEDVSQKGTDEVCEFNVSNSIISPGETVISVEVGLDMGPSAIQTGTLILEKDIEMTEE
KQSVQPQQASPLEISETEHLLPVVSDVSPSPAIPDQQIVEEARNSILESGPDWKDYESRE
IVAEESKPKDTELSQESGFKENEINAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLMSMENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASD
DKKINNLLQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagtagaaagcaaggatgagaagagaccagcagaa
gttagtcctcaggataagaggcaggaagaagaggcatcgatgctttgcttcaagagaaga
aagaaaccagccaaagcggtgaagcccagagtcggctctgacgctgctggtgtggcaagg
aagtgtcccctagaagcaggcgcttctgatcagccacaaccccaagtaggggcctgggcc
tcaatcaaacgtcttgtaacacgcaggaaaaggtcagattcttcaaagcagcagaagctc
tttgaggctaaagtgcaacctgaaatcaatgctgaagatgctgatccttctaagaaaaag
gcaaaatccagacttaagattccctgcataaaattctccaaaggggagaaaagaagtaat
cattccaaaattattgaagactcagactgcagcatcagagtccagggagaagctgaaagt
ttggatacaaaaactctgacccaatcagatgaccaggccacaaagaccaaggtcacccag
gatgtaagtgaagatgtctctcagaaagggactgatgaggtctgtgaattcaatgtgagc
aacagcataatttctcctggagagacagtgatttcagtagaagttgggttagatatgggg
ccttctgctattcaaacaggaactctaattcttgaaaaagatattgagatgactgaggaa
aagcaaagtgttcaaccccagcaggcaagcccacttgaaatttcagaaacagaacacctg
ctaccagtggtttctgatgtttcgccctcacctgcaatcccagatcaacaaattgtggaa
gaagccagaaacagtatcctagaaagtggaccagattggaaagactatgaaagtagagag
attgtagctgaagagagtaagccaaaagacactgaactgagccaggaatcaggctttaaa
gaaaatgagatcaatgcagagaaacccaaaccagaagaaagcaaaagaatggagccaatt
gctattattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagcaattcttaatgtcaatggaaaatgagcaagtaggagtttttgctaatgacagt
ggttttgaaggtagaacttcagaacaatatgaaacacttttaatagaaacagcctcttct
cttgtcaagaatgctatccagttgtctatagaacagctcgtcaatgaaatggcctctgat
gacaagaaaataaacaaccttctacagtga

DBGET integrated database retrieval system