KEGG   Equus przewalskii (Przewalski's horse): 103560323
Entry
103560323         CDS       T04644                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epz03000]
    103560323 (AHRR)
Transcription factors [BR:epz03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103560323 (AHRR)
SSDB
Motif
Pfam: PAS HLH Gag_p10 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 103560323
NCBI-ProteinID: XP_008532605
Position
Un
AA seq 716 aa
MIPPGECMYAGRKRRKPIQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQEKCPWQPAAGAPLPGDGGLHEGSSVLEGRLLLESLH
GFALVVSAEGMIFYASATIMDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VCGQPLRSETGEDAVLGRLLRAQEGGAGSPTEYSAFLTRCFVCRVRCLLDSTSGFLTMQF
QGKLQFLFGQKRKAPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRAKHRVDISATM
DTKAKTTTSLCESELHGKPSYLAGRSNGENSISVFRTQTDAGHWARVPARASCLCLRGGS
DLIFDPEGAAGDRGAEELGRVSSGSSSTRGQKEIHSYNCHLETSAPGKHLNWTTGKHGQD
GTQLKLEPSKRDLFSVRAVPHGSCMPYLGVQGTLHASGVTAFRNSPSSHPANHSPSAYGS
RTSRALRDRGQGQGHPPTSCPFPQGSLENGLPQPAAQHLAVGGYSTEDAKLRGVPMPPGA
LCNTMLSLDVPIKMESDSGSEDTADGYSVSPGRMWLGASEVAKRQLVTFPTRMHLKSEPD
PRHHCYTPHMGHGLLGAHPRPGRELAPFHPTQCACLEHMHGLPEPEPPPGLCARGPLPPT
LGCDCRAPGAAPVVKREPLDSPSWGPHSQGGVPGVFPKSGLATLMPPKASECTFLP
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgattccgccaggggagtgcatgtacgctggaaggaaaagaaggaagcccattcagaaa
cagaggcccgccgtgggggccgagaagtcaaacccttccaagcggcaccgggaccgcctc
aacgctgagctggaccacctggccagcctgctgccctttccacccgacatcatctctaag
ctggacaagctttcggtcctgcgcctcagcgtcagctacctcagggtgaagagcttcttc
caagccctgcaggagaagtgcccgtggcagccggcggctggtgcccccttgccaggagac
ggcggtctgcacgaagggtcctcggtgctggagggacggctgctgctggagtccctccat
ggcttcgctctggtcgtgagcgcggaaggcatgatattctacgcatcagcaaccatcatg
gactatctgggcttccaccagacggatgtgatgcaccaaaacatctacgactacatccac
gtggatgaccgtcaggacttctgccggcagctgcactgggccatggaccctccccaggtg
gtgtgtgggcagccgctgcgctcggagacaggagaggacgccgtcctgggaaggctgctc
agggcccaggaggggggtgcgggttcgcccacggagtactcggccttcctgacccgctgc
ttcgtctgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaaactgcaattcctgtttggacagaaaaggaaggcaccctcggggaccgtcctg
cccccacgactctccctcttctgcatcgtggtacctgtgctcctgccttccgtggcagag
atgaaaatgaagagtgcatttttgagggcgaagcacagggtggacatctcagcaacaatg
gacacaaaggcaaaaactaccaccagtctgtgtgaatcagaattgcacggaaaacccagt
tacttagcaggaaggagcaatggggaaaacagcatttcggtgttcaggacacagaccgat
gctggccactgggcccgggttccagccagggcctcatgcctgtgcctcaggggtggctct
gacctcatctttgaccctgagggagccgcaggggacaggggagcagaggagctcgggagg
gtgtccagtggctcctccagcacgagggggcagaaggaaatacatagttacaactgccac
ttggagacctccgcacccgggaagcacctgaattggacaacagggaaacacggtcaggat
ggcacccagctgaagctggaacccagcaagcgtgatctgttctccgtgcgtgctgtgcct
cacggttcctgcatgccctacctgggcgtccagggcaccctccatgccagtggcgtcact
gctttcaggaattcacccagctctcacccagcgaaccattcccccagtgcatacggcagc
cggacaagcagagccttgcgggaccgcggtcagggccaggggcaccctcccaccagctgc
cccttcccccaggggagcctggagaatgggctccctcagcccgcagcacagcatcttgca
gtggggggctattctaccgaggatgccaagttgcgaggtgtgccgatgcccccaggagcc
ctgtgcaacaccatgttgtcacttgatgtgcccatcaagatggagagtgactctgggtcc
gaggatacagcagatggctactctgtgtccccaggccgcatgtggctgggagccagtgag
gtggccaagagacagctggtcactttccctaccaggatgcacctgaagtcagagccagac
cccaggcaccactgctacaccccgcatatggggcatggcctgctgggggctcaccccaga
cccggcagggaactggccccgttccaccccacacagtgtgcctgcctggagcacatgcat
ggtcttcccgagccggagcccccgcccggcctctgtgcgcggggccccctgcccccgact
ctgggctgtgactgcagagctcctggagctgcacccgtcgtcaagcgtgagcccctggac
tcgccctcatggggtcctcacagccagggtggggtgcccggggtgttccccaagagtggc
ttggcaacactgatgccgcccaaggcctctgagtgcactttcctgccatag

DBGET integrated database retrieval system