KEGG   Equus przewalskii (Przewalski's horse): 103561050
Entry
103561050         CDS       T04644                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00230  Purine metabolism
epz01100  Metabolic pathways
epz01522  Endocrine resistance
epz04015  Rap1 signaling pathway
epz04020  Calcium signaling pathway
epz04022  cGMP-PKG signaling pathway
epz04024  cAMP signaling pathway
epz04062  Chemokine signaling pathway
epz04072  Phospholipase D signaling pathway
epz04114  Oocyte meiosis
epz04211  Longevity regulating pathway
epz04213  Longevity regulating pathway - multiple species
epz04261  Adrenergic signaling in cardiomyocytes
epz04270  Vascular smooth muscle contraction
epz04371  Apelin signaling pathway
epz04540  Gap junction
epz04611  Platelet activation
epz04713  Circadian entrainment
epz04714  Thermogenesis
epz04723  Retrograde endocannabinoid signaling
epz04724  Glutamatergic synapse
epz04725  Cholinergic synapse
epz04727  GABAergic synapse
epz04742  Taste transduction
epz04750  Inflammatory mediator regulation of TRP channels
epz04911  Insulin secretion
epz04912  GnRH signaling pathway
epz04913  Ovarian steroidogenesis
epz04914  Progesterone-mediated oocyte maturation
epz04915  Estrogen signaling pathway
epz04916  Melanogenesis
epz04918  Thyroid hormone synthesis
epz04921  Oxytocin signaling pathway
epz04923  Regulation of lipolysis in adipocytes
epz04925  Aldosterone synthesis and secretion
epz04926  Relaxin signaling pathway
epz04927  Cortisol synthesis and secretion
epz04928  Parathyroid hormone synthesis, secretion and action
epz04934  Cushing syndrome
epz04935  Growth hormone synthesis, secretion and action
epz04970  Salivary secretion
epz04971  Gastric acid secretion
epz04972  Pancreatic secretion
epz04976  Bile secretion
epz05032  Morphine addiction
epz05163  Human cytomegalovirus infection
epz05166  Human T-cell leukemia virus 1 infection
epz05200  Pathways in cancer
epz05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103561050 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103561050 (ADCY4)
   04371 Apelin signaling pathway
    103561050 (ADCY4)
   04020 Calcium signaling pathway
    103561050 (ADCY4)
   04072 Phospholipase D signaling pathway
    103561050 (ADCY4)
   04024 cAMP signaling pathway
    103561050 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103561050 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103561050 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103561050 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103561050 (ADCY4)
   04062 Chemokine signaling pathway
    103561050 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103561050 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103561050 (ADCY4)
   04912 GnRH signaling pathway
    103561050 (ADCY4)
   04913 Ovarian steroidogenesis
    103561050 (ADCY4)
   04915 Estrogen signaling pathway
    103561050 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103561050 (ADCY4)
   04921 Oxytocin signaling pathway
    103561050 (ADCY4)
   04926 Relaxin signaling pathway
    103561050 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103561050 (ADCY4)
   04918 Thyroid hormone synthesis
    103561050 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103561050 (ADCY4)
   04916 Melanogenesis
    103561050 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103561050 (ADCY4)
   04927 Cortisol synthesis and secretion
    103561050 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103561050 (ADCY4)
   04270 Vascular smooth muscle contraction
    103561050 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103561050 (ADCY4)
   04971 Gastric acid secretion
    103561050 (ADCY4)
   04972 Pancreatic secretion
    103561050 (ADCY4)
   04976 Bile secretion
    103561050 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103561050 (ADCY4)
   04727 GABAergic synapse
    103561050 (ADCY4)
   04725 Cholinergic synapse
    103561050 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103561050 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103561050 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103561050 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103561050 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103561050 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103561050 (ADCY4)
   04714 Thermogenesis
    103561050 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103561050 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103561050 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    103561050 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103561050 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103561050 (ADCY4)
   05163 Human cytomegalovirus infection
    103561050 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103561050 (ADCY4)
Enzymes [BR:epz01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103561050 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 103561050
NCBI-ProteinID: XP_008533665
Position
Un
AA seq 1077 aa
MARLFSPRPQPSEDLFYETYYSLSQQYPLLLMLLAIVLCALLALLAVAWASGRELASDTG
FLTTVLCALGGFSLLLGLASREHRLQRWTRPLSGLVWAALLALGYSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLGMRDATAAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHIESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDEELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYTACTFLVFLSIFI
VQMLVTNRPPALAITYSITFLLFLLLLFICFSEHLTRCVLKGPKVLHWLPALSGLVSTRP
GLRVALGTATILLVFAMAITSLFFLPPASKCPFQAPNVSSMALNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSLFLHSHAWLSDCLIARLYLGPADS
RPGVLKEPKMMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFTVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSAALG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgcagcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctaatgctgctggccatcgtgctctgcgcg
ctcctggcgctgctcgcggtcgcctgggccagtggcagggagctggcctctgacacgggc
ttcctgaccactgtgctgtgcgcgttgggcggcttctcgttgctgctgggcttggcttcc
cgcgagcaccgactgcagcgctggacgcgtcccctgtccggcctcgtgtgggcagcgctg
cttgcgctaggctacagcttcctgttcaccgggggcgtggtgagcgcctgggaccaggta
tcctttttcctctttgtcatcttcacggtctatgccatgctgcccttgggcatgcgggac
gccaccgccgcgggcctcgcctcctcactctcacatctgctggttcttgggctgtatctt
gggcctcaacccgactctaggcccgcgctgctgcctcagctggcagcaaacgcggtattg
ttcctgtgcgggaacgtggctggagcgtaccacaaggcgctgatggagcgcgccctgcgc
gccacgttccgggaggcgctgagttccctgcactcgcgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccaagagatgaag
gcagagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccatagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgaggctggccagtgagtgctcccctaaagagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgccactctcgctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccactggt
gtggacatcaacatgcgtgtgggtgtgcactcaggcagcgtgctctgcggagtcatcggg
ctgcagaagtggcagtacgatgtctggtcgcatgacgtcacactggccaaccacatggag
gccggtggcgtgccagggcgcgtacatatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggatgcagccatggaacaccgagacccgtaccttcgggagctaggg
gagcctacctacctggtcatcgatccccgggctgaggaagaggatgagaagggcactgca
ggagggttgctgtcctctcttgagggccccaagatgcgtccatcactgctgatgacccgc
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacatagagagccca
gtgtccacctccactcctctcccggagaaggccctggcttccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgaggaattggacaccggggatgccaag
ttcttccaggtcattgaacagctcaactctcagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttccgagagaaggagatggagaaagagtatcgactctctgca
ctccccgccttcaaatactacacagcctgcaccttcctggtttttctctccatcttcatc
gtccagatgctggtgacaaacaggcccccagctctggccatcacctatagtatcaccttc
ctcctcttcctcctcctcctcttcatctgtttctcagagcacctgacgaggtgtgtcttg
aaaggccccaaggtgctacactggctgcctgcactgtctggcctggtgtccacacggccc
ggactgcgagtcgccctgggcaccgccaccatccttctcgtcttcgccatggccattacc
agcctgttcttcttaccgccagcatcgaagtgccctttccaggctcccaatgtgtcctcc
atggctttgaacctctcctgggagctccctgggtccctgcctctcatcagcatcccatac
tccatgcactgctgcgtgctgggtttcctctcctgctccctctttctgcacatgagcttc
gaactgaagctgctgctgctcctgctgtggctgacggcctcctgctccctcttcttgcac
tcccacgcctggctgtctgactgcctcatcgcccgcctctatctgggccccgcggattcc
aggccaggggtgctgaaggagcccaaaatgatgggcgctatctccttcttcatcttcttc
tttaccctccttgtcctggctcggcagaatgaatattactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacaatggagaacctgacccggctg
ctcttggagaatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcgtacgagtgtgtttgtgtcctcttcgcctccgtccca
gacttcaaggagttttactctgaatccaatatcaaccacgagggcctagagtgtctgcgg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaaattcagtggc
gtggagaagatcaaaaccattggcagcacctacatggcagctacaggcttaaatgccacc
tctggacaggacgcacagcaggatgctgagcgaagttgcagccaccttggcaccatggtg
gaattcacggtggccctcgggtctaagctagatgtcatcaacaagcactcattcaacaac
ttccgcttgcgtgtggggttgaaccacggaccagtagtggctggagtgattggggcccag
aagccacaatacgacatctggggcaacacggtgaacgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgactgaagagacagctcgggccctgcagtctttaggc
tacacctgctacagccggggtgtcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcctgaacacagatttgacacgaactggacctccctctgccgccctgggctga

DBGET integrated database retrieval system