KEGG   Equus przewalskii (Przewalski's horse): 103562493Help
Entry
103562493         CDS       T04644                                 

Gene name
HSPA1L
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1 like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz03040  Spliceosome
epz04010  MAPK signaling pathway
epz04141  Protein processing in endoplasmic reticulum
epz04144  Endocytosis
epz04213  Longevity regulating pathway - multiple species
epz04612  Antigen processing and presentation
epz04915  Estrogen signaling pathway
epz05134  Legionellosis
epz05145  Toxoplasmosis
epz05162  Measles
Brite
KEGG Orthology (KO) [BR:epz00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103562493 (HSPA1L)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103562493 (HSPA1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103562493 (HSPA1L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103562493 (HSPA1L)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103562493 (HSPA1L)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103562493 (HSPA1L)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103562493 (HSPA1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103562493 (HSPA1L)
  09172 Infectious disease: viral
   05162 Measles
    103562493 (HSPA1L)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103562493 (HSPA1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:epz01009]
    103562493 (HSPA1L)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:epz03041]
    103562493 (HSPA1L)
   03009 Ribosome biogenesis [BR:epz03009]
    103562493 (HSPA1L)
   03110 Chaperones and folding catalysts [BR:epz03110]
    103562493 (HSPA1L)
   04131 Membrane trafficking [BR:epz04131]
    103562493 (HSPA1L)
   03051 Proteasome [BR:epz03051]
    103562493 (HSPA1L)
   03029 Mitochondrial biogenesis [BR:epz03029]
    103562493 (HSPA1L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103562493 (HSPA1L)
Protein phosphatases and associated proteins [BR:epz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103562493 (HSPA1L)
Spliceosome [BR:epz03041]
 Complex B
  Other components
   Prp19 complex
    103562493 (HSPA1L)
 Complex C
   Prp19-CDC5 complex
    103562493 (HSPA1L)
Ribosome biogenesis [BR:epz03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103562493 (HSPA1L)
Chaperones and folding catalysts [BR:epz03110]
 Heat shock proteins
  HSP70 / DNAK
   103562493 (HSPA1L)
Membrane trafficking [BR:epz04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103562493 (HSPA1L)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103562493 (HSPA1L)
Proteasome [BR:epz03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103562493 (HSPA1L)
Mitochondrial biogenesis [BR:epz03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103562493 (HSPA1L)
Exosome [BR:epz04147]
 Exosomal proteins
  Proteins found in most exosomes
   103562493 (HSPA1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 103562493
NCBI-ProteinID: XP_008535774
Position
Un
AA seq 641 aa AA seqDB search
MAAAKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINDEGKPKVMVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKAGQGERHVLIFDLGGGTFDVSVLTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLFEGIDFYTSIT
RARFEELCADLFRSTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLEAEKYKAEDEAQREKISA
KNALESYAFNMKSAVSDEGLKGKISESDKKKILTKCNEVLSWLEANQLAEKDEYDHKRKE
LEKVCNPIITKLYQGGCAGPACGRGYTPGRAATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctaagggaatggccattggcattgacctgggtaccacctactcgtgcgtg
ggggtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccact
cccagctacgtggccttcacggacaccgagcggctcattggggatgcagccaagaaccag
gtagccatgaatccccagaacactgtctttgatgccaaacgtctgatcggcaggaaattt
aatgatcctgtagtgcaatcagacatgaaactttggccttttcaagtaatcaatgacgaa
ggcaagcccaaggtaatggtgtcctacaaaggggagaaaaaagctttctaccctgaggaa
atttcttctatggtgctgactaagatgaaggagactgctgaggcttttttgggccaccct
gtcaccaatgctgtgatcactgtgccagcttatttcaatgactctcaacgccaggccacc
aaggatgcaggtgtgattgcgggtctcaatgtgctaagaattatcaacgaacccacagct
gctgccattgcctatggcttagataaagcaggtcagggagagagacatgttctgatcttt
gatctgggtggaggcacatttgatgtgtccgtcctgaccatagatgatgggatttttgag
gtaaaggccacagctggggacacccacctgggtggagaggactttgacaacaggcttgtg
agccactttgtggaagagttcaagaggaaacacaagaaggacatcagtcagaacaagcgg
gctgtgaggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcatccagcacc
caggccaacttggaaattgattcactttttgaaggcatcgacttctacacgtccatcacc
agagcccggtttgaagagttgtgtgcagacctgtttaggagcactctggagcctgtggag
aaggctcttcgtgatgcgaagatggataaggctaaaatccatgacattgttttagtaggg
ggctccacccgtatccctaaagttcagaggctgctgcaggactactttaatggccgtgat
ctcaacaagagcatcaaccccgatgaggcggtggcctatggggctgcagtacaggcagcc
attttgatgggcgacaagtctgaaaaggtacaggacctgcttttgttggatgtggctccc
ctgtccctagggttggagacggcggggggcgtgatgactgtcctgatcaagcgcaactcc
accatccccaccaagcagacgcagatctttaccacctactcagataaccagccaggggta
ttgatccaggtctacgagggcgagagggccatgacgcgggacaacaacctgctgggacgc
tttgatctgactggaatcccccctgcacccagaggagttcctcagatcgaggtgaccttt
gacatcgacgccaatggtattcttaatgtaacagccatggataagagcacaggcaaggcc
aacaagatcaccatcaccaatgacaagggccgcctcagcaaagaggagatcgagcgcatg
gttctggaggctgagaaatataaagctgaagatgaggcccagagagagaaaatctctgca
aaaaatgccttagaatcctatgcttttaacatgaagagtgctgtgagtgatgaaggcttg
aagggcaagattagtgagtctgataaaaagaaaatactgactaaatgcaatgaggtcctc
tcatggctggaggccaatcaactggctgagaaagatgagtatgatcataagagaaaggaa
ctcgagaaagtgtgtaacccaattatcacaaaactctaccagggaggatgcgccgggcct
gcctgtggaagagggtatacgcctggaagggctgccacaggccccaccatcgaagaagta
gattaa

DBGET integrated database retrieval system