KEGG   Equus przewalskii (Przewalski's horse): 103563501Help
Entry
103563501         CDS       T04644                                 

Gene name
MARS2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00450  Selenocompound metabolism
epz00970  Aminoacyl-tRNA biosynthesis
epz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103563501 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103563501 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:epz01007]
    103563501 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:epz03016]
    103563501 (MARS2)
Enzymes [BR:epz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103563501 (MARS2)
Amino acid related enzymes [BR:epz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103563501 (MARS2)
Transfer RNA biogenesis [BR:epz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103563501 (MARS2)
 Prokaryotic type
   Other AARSs
    103563501 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 D123 DUF5600
Motif
Other DBs
NCBI-GeneID: 103563501
NCBI-ProteinID: XP_008537129
Position
Un
AA seq 573 aa AA seqDB search
LRDSRLRHYSSCPLGARDDAQDARAYFTTPIFYVNAAPHIGHLYSALLADALCRYRRLRV
PSAAATRFSTGTDEHGLKIQQAAATAGLAPAELCDQVSAQFQQLFREASISSTDFIRTTE
ARHRVAVQHFWGVLKARGLLYKGLYEGWYCASDECFLPEAKVTRQPGPSGDLCPVSLESG
HPVSWTKEENYIFRLSQFREPLQRWLRGXXXXXXPEPFHHAVLQWLEEELPDLSVSRRSS
HLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFKSWWPTTSHIIGKDILKFHAIYW
PALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGNVVDPRSCLDRYTVDGFRYFLLRQGVP
HWDCDYYDEKVVKLLDSELADALGGLLNRCTAKRINPSGTYPAFCTTCFPSEPGLVGPSV
RAQAEDYALVSAVATLPKQVADHYDNFQIYKALEAVSSCVRQTNGFVQRHAPWKLNWQSP
VDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSATERGLGELYFLPRFHGH
PCPFEGRRLGSETGLLFPRLDQSRAWLLKAHRT
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
ctacgggactcgaggctacgccactacagttcatgtcctctcggtgcccgcgacgatgcc
caggacgcgcgcgcctacttcacaacacctattttctacgtgaacgcggcgccgcacatc
ggacacctgtactcggcgctactagcggatgccctgtgccgctaccgtcgcctccgagtt
cccagcgccgccgccacgcgcttctccaccggtactgacgagcacggcctgaagattcag
caggcggcagccactgcaggcctggccccagccgagctttgcgaccaagtctctgcccag
ttccagcagcttttccgggaggccagcatctcctccacggacttcatccgcaccaccgag
gcccggcatcgggtggctgtgcagcacttctggggggtgctgaaagctcggggtctgctc
tacaaggggctctatgaaggttggtattgcgcctccgacgagtgcttcctgcctgaggcc
aaggtcacccggcagccgggcccgtcgggggacttgtgtcctgtctctctcgagagcggg
catcccgtctcctggaccaaggaagaaaactacattttcaggctttcccagtttcgggag
ccgctccagcggtggctacggggnnnnnnnnnnnnnnnnnccccggagccattccatcac
gcagtccttcagtggctagaggaggagctgccggacctgtccgtctctcgcaggagtagc
cacttgcactggggtattccggtgcccggggacgattcgcagaccatctacgtttggctg
gatgcgttggtcaactaccttactgtaatcggctacccaaatgctgagtttaaatcttgg
tggccgaccacctctcatatcataggcaaggacattctcaaattccatgctatctattgg
cctgccctcctcttaggggctggcatgagcccaccacaccgcatctatgtccactctcac
tggacggtctgtggccaaaagatgtctaagagcttgggcaacgtggtggatcctaggtct
tgccttgaccgctatactgtggacggtttccgatactttctccttcggcagggcgtcccc
cactgggactgtgattactatgatgaaaaggtggttaaattgctagactctgagctggca
gatgctttgggaggtctcttgaatcgatgcactgccaaaaggataaatccttccgggacg
tacccggccttctgcactacctgctttcccagtgagccagggttggtggggccatcagtt
cgtgctcaggcagaggactatgctcttgtgagtgcagtggccactttgcccaagcaggta
gcagaccactatgataactttcagatctataaggctctggaggcagtgtccagctgtgtc
cggcaaactaatggctttgtccaaaggcatgcaccgtggaagttaaattggcagagccca
gtggatgctccctggctgggtactgtgcttcatgtggccttggaatgtttgcgagtcttt
ggaactttgctccagcctgtcaccccaagcctagctgataagctgctatccaggttgggg
gtctctgccacagagaggggccttggagagctctatttcttgcctcgattccatggccat
ccctgcccttttgaagggaggaggctgggatctgaaactgggctcttgtttccaagactg
gaccagtccagggcctggctgctgaaagcccataggacctag

DBGET integrated database retrieval system