KEGG   Equus przewalskii (Przewalski's horse): 103564548
Entry
103564548         CDS       T04644                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103564548 (ANKRD53)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103564548 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 103564548
NCBI-ProteinID: XP_008538585
Position
Un
AA seq 471 aa
QPGPASSSSSSPHPSPLPSPLPHSDSSPVDERDQRAIGRDSELFAAALGNLEWLRFCLNR
DRGEILANDKGFTAIHFAAQSCKLACLQVLVEEYKFPVNLPTNNGQTPLHLVIHRDNKTM
ALPCIHYLLKQGAALNTRTCNGSTPLHLAAREGLLNCVEVLVQNGANVHAQDAMGCKPID
YCKVWNHRICARFLKDAMWKWDKKNFAREMGKLKRLKDQLALMEQDYLTDYQKEHKSLRE
ADFKKWLHGKRLPGGQSLMGNSEQEPCAPPQAVAVSKTPRHRGLWPPKSFHPSPEARLQQ
TLQLKPPPLVMPKPIYMRPMVRRPKLWNLSNNPARSPTIQIGYPQGIRLGVHPDPWPEHD
FSSFLRVRSNGHGGVSLCTVTGKLVSPVPRLPFEVIVRGLYPSVQPYRMKVPQDLYSVSM
RDVPRKRHLGDDTFWTDSLAMNLRETFDEAFLAAVRAHQGLLTLSSPKTHP
NT seq 1416 nt   +upstreamnt  +downstreamnt
cagccgggaccagcctcttcctcgtccagttccccgcatccttccccgcttccctcccca
ctaccccacagcgactctagtcccgtcgatgagcgggaccagagggcgattgggagagac
tccgagctgttcgcggccgcgctgggcaacctggaatggttgcggttctgtctgaatcgg
gaccgtggagaaatcctggccaatgacaagggtttcactgccatccactttgcagcccag
agctgcaagctggcatgcctgcaggtcttggtagaggagtacaagtttccagtaaacctg
cccaccaacaatggccagacccctctgcacctcgtcatccacagggacaacaagaccatg
gccctcccctgcattcactatctgcttaagcaaggcgcggccctcaacactcggacgtgc
aatggctccacgcccctgcacctggcagcccgtgaaggcctgctgaactgtgtggaggtc
ctagtgcaaaatggcgccaatgtccatgcccaggatgccatgggctgcaagcccatcgac
tattgcaaagtatggaaccaccgcatctgtgcccgcttcttgaaggatgccatgtggaaa
tgggacaagaagaactttgctcgtgagatggggaaactgaagaggctcaaggaccagctg
gccctcatggagcaggactacctgactgactatcaaaaagagcacaaaagtctgagagag
gctgatttcaagaagtggcttcatggcaagcggctgcccggaggccaatccctgatgggc
aactctgagcaagagccttgtgccccaccccaggccgttgccgtctccaagacgcccagg
cacaggggattgtggcctcccaaaagcttccacccctcgccggaggcgcgcctgcaacag
actctgcagctcaagccgccgcccttggtgatgcccaagcccatctacatgcggcccatg
gtcaggaggcccaagttgtggaaccttagcaacaaccccgccagatcccccaccatccag
atcggctacccacagggcatccgcctgggagtgcatccagacccctggccagagcacgac
ttcagcagcttcctcagggtgaggtccaacgggcacggtggtgtgagcctatgcacagtg
accggcaagctggtgtcgcctgtgccccggctgccttttgaggtgatagtccgcgggctg
tacccttcggtgcagccatacaggatgaaggtgccccaggacctttactccgtcagcatg
agggacgtgcccaggaagcggcacttgggcgacgacaccttctggactgatagtctggcc
atgaacctgcgtgagacgtttgatgaagccttcctggcagctgtgcgagcccatcaaggg
ctcctcactctgtcctcccctaaaacccacccataa

DBGET integrated database retrieval system