KEGG   Equus przewalskii (Przewalski's horse): 103564931Help
Entry
103564931         CDS       T04644                                 

Gene name
CRYL1
Definition
(RefSeq) crystallin lambda 1
  KO
K13247  L-gulonate 3-dehydrogenase [EC:1.1.1.45]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00040  Pentose and glucuronate interconversions
epz01100  Metabolic pathways
Module
epz_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103564931 (CRYL1)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.45  L-gulonate 3-dehydrogenase
     103564931 (CRYL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_Gly3P_dh_N FAD_binding_3 ApbA
Motif
Other DBs
NCBI-GeneID: 103564931
NCBI-ProteinID: XP_008539088
Position
Un
AA seq 319 aa AA seqDB search
MASSAAGVVAIVGSGLIGQSWGMLFASGGFKVKLYDIEQQQVTKALENIRKEMKLLEQAG
SLKGSLSAEEQLSLIRGCASVEEAVEGAMHIQECVPENLELKRKIFAQLDRAVDDTIVLS
SSTSCLLPSQLFAGLAHVKQCIVAHPVNPPYYVPLVELVPHPETSPATVDRTHALMQKIG
QSPIRVLKEIDGFALNRLQYAIISEAWRLVQEGIVSPSDLDLVMSDGLGMRYAFIGPLET
MHLNAEGMLSYCDRYREGMKRVLKSFGPVPEFSGPTVEKINQAMCVKIPDDPDRLAARRK
WRDECLMSLARLKRQMQSQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcagcggccggcgtggtggccatcgttggcagtggactcattgggcaaagc
tggggtatgctttttgccagtggaggcttcaaagtgaaactctatgatatcgagcaacag
caggtcacaaaagccctggaaaacatcagaaaagagatgaagttgctggagcaggcaggc
tctctgaaaggctctctgagtgctgaagagcagctgtcactcatccgcggttgtgcaagt
gttgaagaagcagtagagggcgccatgcacattcaggaatgtgttccagaaaacctggag
ctgaagaggaagatcttcgctcagttggaccgagccgtcgacgacacgattgtcttgagc
agctccacctcgtgcctcctgccctcccagctgtttgccggtttggcacatgtgaagcag
tgcattgtggcccatcctgtaaatccaccatattatgtcccgttggttgagctggtccca
cacccggagacgtcccctgcaacagtggacagaacccatgccctgatgcagaagatcgga
cagtccccgatcagggttctgaaggagatcgacggcttcgctctgaatcgcctccagtac
gcgatcatcagcgaggcctggaggctcgtgcaggaaggaatagtgtctccaagcgacctt
gaccttgtcatgtcagatggcctgggcatgcggtatgcgttcatcggacccctggaaacg
atgcatctcaacgccgaaggtatgttaagctactgtgacagatacagagaaggcatgaaa
cgtgtcctcaagagttttggacctgttccagagttttccgggcccactgttgaaaaaatc
aaccaggccatgtgtgtgaaaattccagatgatccggatcgcttagctgcccgaaggaag
tggagggatgaatgccttatgagtcttgccagattgaaaaggcagatgcagtcccagtaa

DBGET integrated database retrieval system