KEGG   Equus przewalskii (Przewalski's horse): 103565287Help
Entry
103565287         CDS       T04644                                 

Gene name
CACNA1I
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04020  Calcium signaling pathway
epz04713  Circadian entrainment
epz04925  Aldosterone synthesis and secretion
epz04927  Cortisol synthesis and secretion
epz04929  GnRH secretion
epz04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103565287 (CACNA1I)
   04020 Calcium signaling pathway
    103565287 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103565287 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    103565287 (CACNA1I)
   04927 Cortisol synthesis and secretion
    103565287 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103565287 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103565287 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:epz04040]
    103565287 (CACNA1I)
Ion channels [BR:epz04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103565287 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 103565287
NCBI-ProteinID: XP_008539519
Position
Un
AA seq 1694 aa AA seqDB search
MAESSSPPSSSAAAAAPAEAEPGVTEQPGPQSPPPSPPGLEEPLDGADPDVPHPDLAPVA
FFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSERCKILQVF
DDFIFVFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIR
TVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNR
CFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKD
DVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEG
WVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQR
YLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQAPGLGAPTSAKPG
PHAKEPRHHKLCPGHSPQDPHALVQPISAMLASDPSSCPRCQCEAGRRPSGQEGSGSGDS
EGGEAEADGDGARSSEDCTSSGLGKEDEEEPADGAARLCGDVWREMRAKLRGIVDSKYFS
RGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMLLKLAAFGLFDYLRNP
YNIFDSIIVIISIWEIVGQADGSLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVA
TFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDW
NVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDRSSS
NMEEFDKLQEGLDSGGDPKLCPIPMTPNGHLDANLPLGGHLGPAGTVAPAPRLSLQPDPM
LVALGSRKSSVMSLGRVSYDQRSLTLCFRVRKMIDVYKPDWCEVREAWSVYLFSPENRFR
VLCQTVIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMT
LKVVSLGLYFGEEAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGGLAMGSLRPWSLPASV
ISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITN
RSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNP
WMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQ
RLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYM
FTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIR
IMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLV
CNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTQDERGCLSSLQFV
SPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHSLGPSPRPA
TSSPGAPGRGPAGPVGGGHCALPTPLAATWPIIPPVPTPSPSAXENLWLDSVSLIIKDSL
EGELTIIDNLSGSIFHHYASPPGCDKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSL
EDPTACLPGIKDNK
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagctcctcaccgccctcctcctctgccgcagcggcagccccggctgaggct
gagccgggagtcacggagcagccagggccccagagcccgcctccctcccctccaggcctg
gaggagcctctggatggagctgacccggatgtccctcacccggatctggcacccgtggcc
ttcttctgcctgcgacagaccaccagcccccggaactggtgcatcaagatggtgtgtaac
ccgtggttcgaatgtgtcagcatgctggtgatcctgctgaactgcgtgacacttggcatg
taccagccctgcgacgacatggactgcctgtccgagcgctgcaagatcctgcaggtgttt
gacgactttatcttcgtcttctttgccatggagatggtgctcaagatggtggccctgggc
atttttggcaagaagtgctaccttggggacacatggaaccgactggacttcttcattgtc
atggcagggatggtcgagtactccctggaccttcagaacatcaacctgtcggccatccgc
accgtgcgcgtcctcaggcccctcaaagccatcaaccgtgtgcccagtatgcggatcctg
gtgaacctgctcctggacacgctgcccatgctggggaacgtcctcctcctctgcttcttt
gtcttcttcatctttggcatcatcggcgtgcagctctgggccggcttactgcgcaaccgc
tgcttcctggaggagaacttcaccatacaaggggatgtggccctgcccccctactaccag
ccagaggaggatgacgagatgcccttcatctgctcgctgtctggggacaatggcatcatg
ggctgccatgagattcccccgctcaaggagcagggccgcgagtgctgcctgtccaaggac
gacgtctacgactttggggcggggcggcaggacctcaatgccagcgggctctgtgtcaac
tggaaccgctactacaacgtgtgccgcacgggcagcgccaacccccacaagggcgccatc
aactttgacaacatcggctatgcctggatcgtcatcttccaggtgatcactctggagggc
tgggtggagatcatgtactacgtgatggatgctcactccttctacaacttcatctatttt
atcctgctcatcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcg
acccagttctcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgc
tacctgtcctccagcacggtggccagctacgccgagcccggcgactgctatgaggagatc
ttccagtacgtctgccacatcctgcggaaggccaagcgccgcgccctgggcctctaccag
gccctgcagagccggcgtcaggccccgggcctgggggcacccacctccgccaagccgggg
ccccacgccaaggagcccaggcaccacaagctgtgcccaggccacagcccccaggaccct
catgcgctggtgcagcccatctccgccatgctggcctccgacccttccagctgcccccgc
tgccagtgtgaggcgggccggcgtccctcgggccaggagggctcgggctccggggactcg
gagggtggcgaggccgaggcagatggggacggggcccggagcagcgaggactgcacctcc
tcggggctggggaaggaggacgaggaggagcctgcggatggcgccgcccggctgtgcggg
gatgtgtggcgggagatgcgagccaagctgcgaggcatcgtggacagcaagtacttcagc
cggggcatcatgatggccatcctggtcaacaccgtcagcatgggcatcgagcaccatgag
cagcccgaggagctgaccaacatcctggagatctgcaacgtggtcttcaccagcatgttc
gccctggagatgctcctgaagctggccgccttcgggctcttcgactacctgcgcaacccc
tacaacatctttgacagcatcattgtcatcatcagcatctgggagatcgtggggcaggcg
gacggcagcctgtcggtgctgaggaccttccggctgctgcgggtgctgaagctggtgcgc
ttcatgcccgcgctgcgccgccagctcgtggtgctcatgaagaccatggacaacgtggcc
acgttctgcatgctgctcatgctcttcatcttcatcttcagcatcctcgggatgcacatc
tttggctgcaaattcagtctgcgcacagacacgggcgacacggtccccgacaggaagaac
ttcgactccctgctgtgggccatcgtcactgtgttccagatcctcacccaggaggactgg
aacgtcgtcctctacaacggcatggcctccacctccccctgggcctccctctactttgtt
gccctcatgaccttcggcaattacgtgctcttcaacctgctggtggccatcctggtggag
ggcttccaggcagagggcgacgccaatcgctcctactcagacgaggaccggagctcatcc
aacatggaggagtttgacaagctccaggagggcctggacagcggtggagatcccaagctc
tgtccaatccccatgacccccaatgggcacctggacgccaacctccctctgggtggacac
ctgggccccgctgggactgtggcacctgccccccgcctctcactgcagccggaccccatg
ctggtggccctgggctcccgcaagagcagtgtcatgtcactggggagggtgagctacgac
cagcgctccctgactctgtgcttccgcgtccgcaagatgatcgacgtctacaaacctgac
tggtgcgaagtccgcgaggcctggtccgtctacctcttctcccccgagaacaggttccgg
gtcctgtgtcagaccgtcatcgcccacaagctctttgactatgtcgtcctggcctttatc
ttcctcaactgcatcaccatcgccctggagcggccgcagatcgaggccggcagcaccgaa
cgcatcttcctcaccgtgtccaactacatcttcacagccatcttcgtgggcgagatgacg
ctgaaggtggtctcgctgggcctgtacttcggcgaggaggcgtacctgcgcagcagctgg
aacgtgctggacggcttcctcgtcttcgtgtccatcatcgacatcgtggtgtccgtggcc
tcggccggtgggggcctggctatgggctcactacgtccctggtccctccctgccagtgtc
attagcagggcacctggcttgaagctggtggtggagacactcatctcgtccctgaagccc
atcggcaacatcgtcctcatctgctgtgccttcttcatcatcttcggcatcctgggggtg
cagctcttcaagggcaaattctaccactgtctgggcgtggacacccgcaacatcaccaac
cgctcggactgcgtggccgccaactaccgctgggtccatcacaagtacaacttcgacaac
ctgggccaggccctgatgtccctctttgtcctggcctcaaaggacggctgggtgaatatc
atgtacaacggactggatgctgtcgctgtggaccagcagcccgtgcccaaccacaacccc
tggatgctgctctacttcatctccttcctgctcatcgtcagcttctttgtgctcaacatg
tttgtgggcgtcgtggtggagaacttccacaagtgccgccagcaccaggaggccgaggag
gcgcggcggcgcgaggagaagcggctgcggcgcctggagaagaagcgccggaaggcccag
cggctgccctactatgccacttactgtcccacccggctgctcatccactccatgtgcacc
agccactacctggacatcttcatcactttcatcatttgcctcaacgtggtcaccatgtct
ctggagcactacaaccagcccacgtccctggagacagccctcaagtactgcaactacatg
ttcaccaccgtctttgtgctggaggctgtgctgaagctggtggcgtttggtctgaggcgc
ttcttcaaggaccggtggaaccagctggacctagccatcgtgctgctgtccgtgatgggc
atcacactggaggagatcgagatcaatgcggccctgcccatcaaccccaccatcatccgc
atcatgcgtgtgctgcgcattgcccgcgtgctgaagctgttgaagatggctacaggaatg
cgggccctgctggacacggtggtgcaagctctgccccaggtgggcaacctgggcctcctc
ttcatgctgctcttcttcatctatgccgcgctgggcgtggagctcttcgggaagctggtc
tgcaatgacgagaacccatgcgagggcatgagccggcacgccaccttcgagaacttcggc
atggccttcctcacactcttccaggtctccaccggcgacaactggaacgggatcatgaag
gacacgctgcgggactgcacgcaggacgagcgcggctgcctgagcagcctgcagttcgtg
tcgccgctgtacttcgtcagcttcgtgctcacggcccagttcgtgctcatcaacgtggtg
gtggccgtgctcatgaagcacctggacgacagcaacaaggaggcccaggaggatgccgag
atggacgccgagctggagctggagatggcccacagcctggggcccagcccgcggccggcc
accagctccccgggggcaccgggccgggggcccgcagggccggtggggggggggcactgt
gccctgcccaccccgctggccgcgacctggcccataatcccgcctgtccccaccccgtcc
ccgtccgcctaggagaacctgtggctggacagcgtctctttaatcatcaaggactccttg
gagggggagctgaccatcatcgacaacctgtctggctccatcttccatcactacgcctcg
ccgcctggctgcgacaagtgtcaccatgacaagcaggaggtgcagctggccgagacggag
gccttctccctgaactcggacaggtcctcgtccatcctgctaggtgatgacctgagtctc
gaggatcccacagcctgcctgcctggcatcaaagacaacaag

DBGET integrated database retrieval system