KEGG   Equus przewalskii (Przewalski's horse): 103565346
Entry
103565346         CDS       T04644                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:epz01002]
    103565346 (ADAMTS13)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103565346 (ADAMTS13)
Peptidases and inhibitors [BR:epz01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103565346 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_spondin Reprolysin_3 Reprolysin_4
Other DBs
NCBI-GeneID: 103565346
NCBI-ProteinID: XP_008539600
Position
Un
AA seq 1419 aa
MSELQLWGRCVQGILTSAFLLLGCWGLSDFQQQFLQALEPEEVTSYFGPDTTVKGRPPSP
RLQRRAAGSILHLELLVAVGPDVYQAHQDDTERYVLTNLNMGSELLRDPSLGAQFRVHLV
KMVILTRPEDAPDITANITSSLRSVCEWSRTVNPQDDTDPRHADLVLYITRFDLELPDGN
RQVRGVTQLGGACSSSWSCLITEDTGFDLGVTIAHEIGHSAGRARCVWDPPGLQPRSSGH
PPEGHPGLYYGADEQCRVTFGPTAVACTFTREHLDMCQALSCHTDPLDQSSCSRLLIPLL
DGTECGVEKWCSKGHCRSLAELSPVGAVHGHWSGWGLPSPCSRSCGGGVVTRRRQCNNPR
PAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCAETNGKPLSLSPGSTSFYRWDAAAR
YSQGDALCSHMCRAVGESFIVRRGDSFLDGTRCVPSGWQEDGTLSLCVSGHCRTFGCDGR
MDSQQVRDVCQVCGGDNSTCSRQSGSFTAGRAREYVTFLTVTPNLTSIYVANQRPLFTHL
AVRIRGRYVVAGNSSISPSTTYPSLLEDSRVEYKVTLTEDRLPRREEIRIRGPKGTPPGV
QVYRRYGEEYGELTRPDITFTYFQPKQRQAWTWAAVRGACSVSCGAGLRWVTYGCLDQAR
NEWVEPAQCGGSRQPAAWQESCAPKPCPPYWAAGDFGPCSASCGGGLRERAVRCVEAQGG
LLRTLPLAQCRALAPQPELVETCNSQPCPPRWEESNACSSSCGAERAAQNMTCVPGADGL
EMPATAGPCSPDEKLPTLKPCVAMACPPTWGHLDPQAPGEEAASPSGSARLEAHIAHVWM
PLAGTCSVSCGRGLRELHFVCMDSALRTPVREELCDLASKPGSRQEVCQAVPCPARWETR
ALAPCPVTCGGGQVLLAVRCVRPDRGQLVPLPHSKCWPVPRPSPFKDCSPEPCPARWRYK
LAACSVSCGGGVVRRIPYCARAQGEDKDEEILPDAQCQGLPRPEQQEACSPEPCPPRWKV
MSLGPCSASCGLGTATRSVACVQRDQGRDVEVDGAACAALVQPQASIPCVTADCSYRWHV
STWMQCSVSCGDGIQRRHDACLGPQAQVPVPADFCQHLPKPATVRGCWAGPCERQGTPSP
VPHEEATAPGQTTPATADASPEQPQRQTPLSSPGSWLPPRPQESPVESSACGRQHLEPTG
TIDMRGPGRVDCAVAIGRPLGEVVTLQVLESSLNCSTGEMLLLWGRLTWRKMCRKLSGMT
FSSKANTLVVRQRRVRPGGGVVLRYSSRPAPETFHRDCDTQLFGPWGEIVSPLMSPDGRN
VGGCRVFIDVAPRARIAIHALVTNRATGTEGTDASYILIRDIHSLRTTTFLGQQALYWES
EGSRAEMEFSQGFLEAQASLRGQYWTLRSRAQERGSTLP
NT seq 4260 nt   +upstreamnt  +downstreamnt
atgagcgaacttcagctctggggaagatgcgtgcagggaatcctcacttctgccttcctt
ctcctgggctgctggggactctctgatttccagcagcaatttctccaggctttggaacca
gaggaagtgacttcttactttggtcctgacactactgtaaaaggccgtcctccttcccct
cgcctccagagacgggctgctgggagcatcctgcacctggagctgctggtggccgtgggc
cccgacgtctaccaggctcaccaggatgacacggagcgctacgtgctcaccaacctcaac
atggggtcagaactgctgagggacccatccctgggggctcagttccgagtgcacctggtg
aagatggtcatcctgacgcggcccgaggatgctccagatatcacagccaacatcacctcg
tcactgcggagcgtctgtgagtggagcaggacggtcaacccccaggacgacacggatccc
aggcatgccgacctggttctctacatcaccaggtttgacctggagttgcctgatggcaac
cggcaggtgcggggggtcacccagctggggggtgcctgctcctcctcttggagctgcctc
atcactgaggataccggcttcgacctgggggtcaccatcgcccatgagattgggcacagc
gcaggacgggcgcgctgcgtgtgggacccaccggggctgcagccccggtcctcggggcac
cctcccgaggggcaccccggcctctactatggtgctgacgaacagtgccgcgtcaccttc
ggccccacagcggtcgcctgcaccttcaccagggagcacctcgacatgtgccaggctctc
tcctgccacacagaccccctggaccaaagcagctgcagccgcctcctcattcctctcctg
gatgggacagagtgtggcgtggagaagtggtgctccaagggtcactgccgctcgctggca
gagctgagtcctgtgggggccgtgcacgggcactggtctggctggggtctccccagccct
tgctcccgctcctgtggaggaggtgtagtcaccaggaggcggcagtgtaacaaccccaga
cctgcctttggtgggcgtgcctgcgtcggtgctgacctccaggcggagatgtgcaacact
caggcctgcgagaagacccagctggagttcatgtcagagcagtgcgctgagaccaacggg
aagccgctgtccctttccccgggcagcacgtccttctaccgctgggacgccgctgcacgg
tacagccaaggggatgctctgtgcagtcacatgtgccgggctgttggcgagagcttcatt
gtgaggcgtggggacagtttcctggatgggacccgatgtgtgccaagcggctggcaggag
gatgggaccctgagcctgtgcgtgtcgggccactgcaggacgttcggctgtgatggcagg
atggactcccagcaggtgcgagacgtgtgccaggtgtgtggaggggacaacagcacgtgc
agccgacagagtggctccttcacggccgggagagccagagagtacgtcaccttcctgaca
gttacccccaacctgaccagtatatacgtcgccaatcagaggcctctcttcacgcacttg
gcagtgaggatccgagggcgctacgtcgtggccgggaattcgagcatctctcccagcacc
acctacccctccctcctggaggacagccgtgtcgagtacaaagtgaccctcactgaggac
cggctgccccgccgggaggagatccgcatccggggacccaaagggactcctcctggtgtt
caggtttacaggcgctacggcgaggagtatggcgaactcacccgcccagacatcaccttc
acctacttccagcctaagcagcggcaggcctggacatgggccgccgtgcggggggcctgc
tcggtgagctgtggggcagggctgcgctgggtgacctacggctgtctggaccaggccagg
aacgagtgggtggagcctgcccagtgcggagggagccggcagccagcggcatggcaggag
tcctgtgcccccaagccctgccccccatactgggcagctggagactttggcccctgcagc
gcctcctgtgggggaggtctgcgggagcgggcagtgcgctgcgtggaggcccagggtggc
ctcctgaggacattgcccctggcccagtgcagagcgctggccccgcagccagagctggtg
gaaacttgtaactcccagccctgccctcccaggtgggaggagtccaacgcgtgctcatcg
tcctgtggggcagaacgggctgcacagaacatgacatgcgtgccgggggcagatggcctg
gagatgccagcgactgctgggccctgctccccggatgagaagctacctaccctcaagccc
tgtgtggcgatggcctgtcctcccacctggggccatctggaccctcaggctccaggagag
gaggctgcatccccatcaggcagtgccaggctggaggctcacattgcacacgtgtggatg
cccctggcgggaacttgctccgtctcctgtggtcgaggcctgagggagctgcattttgtg
tgcatggacagtgccctcaggacacccgtccgggaagagctttgtgacctggcaagcaag
cctgggagccggcaggaggtctgccaggctgtcccatgcccggctcggtgggagacccga
gccttggcaccgtgcccagtgacctgtggaggggggcaggtgctgctggctgttcgctgt
gtgaggccggaccgtggccagttagtccctctgccccattccaagtgctggccagtgccc
cggcccagccccttcaaggactgcagcccggagccctgccctgccaggtggcggtacaag
ctggcggcctgcagcgtgagctgtgggggaggggttgtgcggaggatcccgtattgtgcc
cgggcccagggggaggacaaggatgaggagatcctgccagacgcccagtgccaggggctg
cctcgccctgagcagcaggaggcctgcagcccggagccctgcccgcccaggtggaaagtc
atgtccctgggcccatgctcggctagctgtggtcttggcaccgccacacgctccgtggcc
tgtgtgcagcgggaccaaggccgggacgtggaggtggatggggcagcctgtgcagctctg
gtgcagccacaggccagcatcccctgtgtcactgccgactgctcctaccggtggcatgtc
agcacctggatgcagtgctccgtctcctgtggggatggcatacagcgccggcacgacgcc
tgccttggaccccaggcccaggtgcccgtgccagctgacttctgccagcacttgcccaag
ccagcgacggtgcggggctgctgggccggtccctgtgaaaggcaggggacgcccagcccg
gtgccccacgaggaagccactgctccaggccagaccacgcctgccactgcggatgcttcc
ccagagcagccccagcgccagacccccctctcctccccaggttcctggctcccgcccagg
ccccaggaaagcccggtggagtccagtgcctgtggccggcagcaccttgagccaacagga
accattgacatgcgaggcccagggcgggtggactgtgcagtggccattgggcggcccctg
ggtgaggtggtgaccctccaagtcctcgagagttccctcaactgcagcaccggggagatg
ctgctgctctgggggcggctcacatggaggaagatgtgcaggaagctgtccggcatgacc
ttcagctccaaagccaacacgctggtggtgaggcagaggcgcgtgcggccaggaggtggc
gtggtactgcggtattccagccgacctgccccagaaaccttccacagagattgtgacacg
cagctctttggaccctggggtgaaatcgtgagcccgttgatgagtccagatgggaggaat
gtggggggctgccgtgtcttcatcgacgtggctccacgggcccggatcgctatccatgcc
ctagtcaccaacagggccaccggaaccgagggaaccgatgccagctacatcttgatccgg
gacatccacagcctgaggacgacgacattccttgggcagcaggcgctctactgggagtca
gagggcagccgggctgagatggagtttagccagggcttcctggaggcacaggccagcctg
cggggccagtactggaccctccgatctagagcccaggagcgcggcagcaccctgccctag

DBGET integrated database retrieval system