KEGG   Equus przewalskii (Przewalski's horse): 103565949Help
Entry
103565949         CDS       T04644                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00561  Glycerolipid metabolism
epz01100  Metabolic pathways
epz04714  Thermogenesis
epz04723  Retrograde endocannabinoid signaling
epz04923  Regulation of lipolysis in adipocytes
Module
epz_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:epz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103565949 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103565949 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    103565949 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    103565949 (MGLL)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103565949 (MGLL)
Peptidases [BR:epz01002]
 Serine Peptidases
  Family S33
   103565949 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_5 Abhydrolase_3 LIDHydrolase PGAP1 DUF1057 Thioesterase Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 103565949
NCBI-ProteinID: XP_008540375
Position
Un
AA seq 187 aa AA seqDB search
MVVSDFHVFVRDVLQHVDIMQKDYPGIPVFLLGHSMGGAIVILTAAERPGHFSGMVLISP
LVLANPESATTFKVLAAKVLNLVLPNMSLGPIDASMLSRNKTEVDLYNADPLICRAGLKG
SADRLCDSKGAYLLMESSKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINMWVSQRTAA
TERGSPP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgtctgacttccacgttttcgtcagggatgtgctccagcacgtggatatcatg
cagaaagactatcccgggatccctgtcttccttctgggccactccatgggaggtgccatc
gtcatcctcacagccgcagagaggccaggccacttctctggcatggttctcatttcacct
ttggttcttgccaatcctgagtcggccaccactttcaaggtccttgctgcaaaagttctc
aaccttgtcctgccaaacatgtccctgggcccgattgacgccagcatgctctctcggaat
aagacggaggtcgacctttataacgcggaccccctcatctgccgggcagggctgaagggc
tctgctgaccgcctgtgcgacagcaaaggagcctacttgctcatggagtcctccaagagc
caggacaagacacttaagatttacgaaggtgcctaccacgttctccacaaagagcttcct
gaagtaaccaactccgtcttccgtgaaatcaacatgtgggtctctcaaaggactgcggcg
acagagagggggtccccgccctga

DBGET integrated database retrieval system