KEGG   Equus przewalskii (Przewalski's horse): 103566602Help
Entry
103566602         CDS       T04644                                 

Gene name
GUCY2D
Definition
(RefSeq) guanylate cyclase 2D, retinal
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00230  Purine metabolism
epz01100  Metabolic pathways
epz04740  Olfactory transduction
epz04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103566602 (GUCY2D)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    103566602 (GUCY2D)
   04740 Olfactory transduction
    103566602 (GUCY2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103566602 (GUCY2D)
Enzymes [BR:epz01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103566602 (GUCY2D)
Protein kinases [BR:epz01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   103566602 (GUCY2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Kinase-like HNOBA
Motif
Other DBs
NCBI-GeneID: 103566602
NCBI-ProteinID: XP_008541267
Position
Un
AA seq 1109 aa AA seqDB search
MTACALLAGGLPDPRLCAPARWPRSPPGLLRTLPRPWPRLRLLLLLLLLPPSVLSAVFRV
GVLGPWACDPIFARARPELAARLAAARLNHDPALEGGPRFEVALLPEPCRTPGSLGAVSS
ALARVSGLVGPVNPAACRPAELLAQEAGVTLVPWGCPGTRAAGTTAPAVTPAADALYALL
REFRWAHVALVTAPQDLWVEAGRALSTALRARGLPVALVTSMEPSDLSGAREALRRVRDG
PRVRAVIMVMHSVLLGGEEQRCLLEAAEELGLADGSLVFLPFDTLHYALSPGPEALAVLA
NNSQLRRAHDAVLTLTRHCPPGGSVLDSLRRAQEHQELPSDLNLQQVSPLFGTIYDAVYL
LAGGVARARAAAGGSWVSGAAVAHHVRDAQVPGFCGALGGAEEPQFVLLDTDAAGDRLFA
TYMLDPTRGSLWSAGTPVHFPRGGRGPGPDPWCWFDPDDICNGGVEPRLVFIGFLLAVGM
GLAGVFLAHYVRHRLLHIQMASGPNKIILTLDDITFLHPQGGSSRKVIQGSRSSLAARSV
SDIRSVPSQPMDSSNIGLYEGDWVWLKKFPGDQHIAIRPATKTAFSKLRELRHENVALYL
GLFLAGGSSGAAAPREGMLAVVSEHCARGSLHDLLAQRDIKLDWMFKSSLLLDLIKGMRY
LHHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQKVLPEPPSAEDQLWTAPELLRD
PALERQGTLAGDVFSLGIIIQEVVCRSTPYAMLELTPEEVVQRLQTPPPLCRPSVSMDQA
PMECIQLMKQCWTEQPDLRPSMDRTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIR
ERTEELELEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMALDI
LSAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY
RIHVNMSTVRILRALDEGFQVEVRGRTELKGKGVEDTYWLVGRRGFNKPIPKPPDLQPGA
SNHGISLQEIPPERRQKLEKARPGQFSGK
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctgcgctctccttgccggtggacttcccgacccccggctctgcgcccccgcg
cggtggcctcggtctccgcccggccttctccggaccctgccccggccctggcctcggctc
cggctcctgctgctgctgcttctcctgccgccctccgtcctctccgccgtattcagagtc
ggggtgctggggccctgggcctgcgaccccatctttgcccgcgcccgcccggagctggcc
gcccgcctggccgccgcccgcctgaaccacgaccctgccctggaaggcgggccccgcttc
gaggtggcgctgctgcccgagccgtgccggacgccaggctcgctgggggcggtgtcctcc
gcgctggcccgcgtctccggcctcgtgggtcccgtgaaccctgcagcctgccggccggcc
gagctactagcccaagaggcgggggtcacgctggtgccctggggctgccctgggacgcga
gcggcgggcaccacggctccggccgtgacacctgcggcggacgccctctacgccctcctt
cgcgagttccgctgggcgcatgtggccttggtcaccgccccccaggacctgtgggtggag
gcgggacgcgcactgtccaccgcactcagggcccgggggctgcccgttgccctagtgact
tccatggagccctcggacctatctggggcccgggaggccctgaggagggtccgggacggg
cccagagtcagagcagtgatcatggtgatgcactccgtgctgctgggcggcgaggagcag
cgctgcctactggaggctgcagaggagctgggcctggctgatggctccctggtcttcctg
ccctttgacacgctccactacgccttgtccccaggcccggaggccttggcggtacttgcc
aacaactcccagcttcgcagggcccatgatgcggtgctcaccctcacgcgccactgtccc
ccgggaggcagcgtgctggacagcctgcgcagggcccaagagcaccaggagctgccctct
gacctcaatctgcagcaggtatccccactcttcggcaccatctacgacgcggtctacttg
ttggcggggggcgtggcgcgggcgcgggcagctgcaggtggcagctgggtgtccggagca
gccgtggcccaccacgtccgggatgctcaggtccccggcttctgcggggccctgggagga
gccgaggagccccagtttgtgctgctggacacggatgcggcgggggaccggctgttcgcc
acatacatgctggaccccacccgaggctccctctggtcggctgggaccccggtgcatttt
cctagagggggacgggggcctgggccggacccctggtgctggtttgacccagacgacatc
tgcaacggaggagtggagccccgcctcgtctttatcggcttcctcctggccgttgggatg
gggctggcaggggtcttcctggcccattatgtgaggcaccggctccttcacatccaaatg
gcctccggccccaacaagatcatcctgactctggacgacatcaccttcctccaccctcag
gggggcagctctcgaaaggtgatccaggggagtcgatcgagtctggctgcccgcagcgtg
tcagacattcgcagcgtccccagccagcccatggatagctccaacattggcctctatgag
ggagactgggtttggctgaagaaattcccaggggatcagcacatcgctatccgcccagca
accaagacagccttctccaagctccgggagctccggcacgagaacgtggctctctacctg
gggcttttcctggcggggggaagcagcggcgccgcggctcccagggaaggcatgctggct
gtggtctcagagcactgtgcccggggctccctccacgacctcctcgcccagagagacata
aagctggactggatgttcaagtcctccctcctactggacctcatcaagggaatgaggtat
ttgcaccatcgaggcgtggctcacgggcggctgaagtcacggaactgcgtggtggacggg
aggttcgtgcttaaagtcaccgaccacggccacgggcgactgctggaagcgcagaaggtg
ttaccggagcctcccagcgcggaggaccagctatggacagccccagagctgcttcgggac
ccagccctggagcgccagggaacgctggccggcgatgtcttcagcctgggcatcatcatt
caggaggtcgtgtgccgcagcaccccctacgccatgctggagctgactcccgaggaagtg
gtgcagaggttgcagacccccccaccgctgtgtcggccctcggtgtccatggaccaggca
cccatggagtgcatccagctgatgaaacagtgctggacagagcagccggaccttcggcct
tccatggaccgcacctttgacctgttcaagagcatcaacaagggccggaagacgaacatc
atcgactcaatgctgcggatgctggaacagtactctagtaacctggaggacctgatccgg
gagcgcacagaggaactggagctggaaaagcagaagacagaccgcctgctgacgcagatg
ctgcctccgtctgtggctgaagccctgaagatggggacacctgtggagcccgagtacttt
gaggaggtgacactgtactttagtgacatcgtgggtttcaccaccatctcagccatgagt
gagcccatcgaagtggtagacctgctcaatgacctctacacgctgtttgatgccatcatt
ggctcccacgatgtctacaaggtggagacaattggggacgcctatatggtggcctcgggg
ctgccccagcgcaatgggcagcggcacgcggcagagatcgcaaatatggcgttggacatc
ctcagtgctgtggggtcctttcgcatgcgccacatgcccgaggtgcccgtgcgcatccgt
atcggcctgcactcgggcccgtgcgtggcgggcgtggtgggcctcaccatgccgcggtac
tgcctgtttggggacacggtgaacactgcctcgcgcatggagtccaccggtctgccttac
cgcatccacgtgaacatgagcactgtgcggattcttcgcgctctggatgagggcttccag
gtggaggtgcgaggccgcacggagctgaagggcaagggcgtcgaggacacgtactggcta
gtgggtagacgcggcttcaacaagcctatccccaaaccgcctgacctgcaaccgggggcc
agcaaccacggcatcagcctgcaggagattcccccggagcggcgccaaaagctggagaag
gcgaggccgggccagttctccggaaagtga

DBGET integrated database retrieval system