KEGG   Equus przewalskii (Przewalski's horse): 103567687Help
Entry
103567687         CDS       T04644                                 

Gene name
PYCR2
Definition
(RefSeq) pyrroline-5-carboxylate reductase family member 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00330  Arginine and proline metabolism
epz01100  Metabolic pathways
epz01230  Biosynthesis of amino acids
Module
epz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    103567687 (PYCR2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     103567687 (PYCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 103567687
NCBI-ProteinID: XP_008542608
Position
Un
AA seq 320 aa AA seqDB search
MSVGFIGAGQLACALARGFTAAGILSAHKIIASSPEMDLPTVSALRKMGVNLTRSNKETV
RHSDVLFLAVKPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLLAFQPAPKVIRC
MTNTPVVVREGATVYATGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFMALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPGQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCVRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSML
TPSSSGKLLTRSPAPGDRKD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgggcttcatcggcgccggccagctggcctgcgccctggcgcggggcttcacg
gccgcaggcatcctgtcggctcacaagatcatagccagctccccggaaatggacctgccc
acggtgtccgcgctcaggaagatgggcgtgaacctgacccgaagcaacaaggagacagtg
aggcacagcgacgtcctgttcctggccgtgaagccacacattatccccttcatcctggac
gagattggggctgacgtccaggccaggcacatcgtggtctcctgtgcggctggtgtcacc
atcagctctgtggagaagaagctactggcgttccagccggcccccaaggtgattcgctgc
atgaccaacacgcctgtggtcgtgcgggagggcgccacggtgtacgccacaggcacccac
gccctggtggaggatgggcagctcctggagcagctcatgagcagcgtgggcttctgcacg
gaggtggaggaagacctcattgacgccgtcacggggctcagcggcagtggccctgcctac
gcgttcatggccctggatgcgttggctgatggtggggtgaagatgggcttgccgcggcgc
ctggcggtccgactgggggcccaggccttgctgggggctgccaagatgctgctggactcg
gagcagcatccaggccagctcaaggacaacgtctgctcccccgggggggccaccatccac
gccctgcacttcctggagagtgggggcttccgctccctgctcatcaatgcggttgaggcg
tcctgcgtccgaacacgagagctgcagtccatggccgaccaagagaagatctccccagcc
gcgctcaagaagaccctcctggacagagtgaagctcgagtcccccacggtgtccatgctg
accccctccagctcggggaagctgctcacgagaagcccagccccaggagacaggaaggac
taa

DBGET integrated database retrieval system