KEGG   Eubacterium rectale M104/1: ERE_22580Help
Entry
ERE_22580         CDS       T02588                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
era  Eubacterium rectale M104/1
Pathway
era00071  Fatty acid degradation
era00280  Valine, leucine and isoleucine degradation
era00310  Lysine degradation
era00362  Benzoate degradation
era00620  Pyruvate metabolism
era00630  Glyoxylate and dicarboxylate metabolism
era00640  Propanoate metabolism
era00650  Butanoate metabolism
era00900  Terpenoid backbone biosynthesis
era01100  Metabolic pathways
era01110  Biosynthesis of secondary metabolites
era01120  Microbial metabolism in diverse environments
era01130  Biosynthesis of antibiotics
era01200  Carbon metabolism
era01212  Fatty acid metabolism
era02020  Two-component system
Brite
KEGG Orthology (KO) [BR:era00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERE_22580
   00630 Glyoxylate and dicarboxylate metabolism
    ERE_22580
   00640 Propanoate metabolism
    ERE_22580
   00650 Butanoate metabolism
    ERE_22580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ERE_22580
   00072 Synthesis and degradation of ketone bodies
    ERE_22580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERE_22580
   00310 Lysine degradation
    ERE_22580
   00380 Tryptophan metabolism
    ERE_22580
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERE_22580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERE_22580
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ERE_22580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:era04147]
    ERE_22580
Enzymes [BR:era01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERE_22580
Exosome [BR:era04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERE_22580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF1153
Motif
Other DBs
NCBI-ProteinID: CBK94138
UniProt: D4JKJ1
Position
complement(2305104..2306288)
Genome map
AA seq 394 aa AA seqDB search
MAKKVVIASACRTAIGKMGGALSNTPAADLGAIVIKEALNRAGVAPEMVDEVKMGCVIQA
AQGQNVARQASIKAGLPIEVPAITINVVCGSGLKCVNDAATMIKAGEADIVVAGGMENMS
MAPYAMTKARFGYRMNNATIIDTMVNDALTDAFNHYHMMITAENVCDKYGITREELDEFS
ANSQQKCEAAIAAGKFDDEIVPVPVKVKKEIVEFKKDEGPRAGTTVETLSKLRCCSGKEG
GLVTAGNASGINDGAAAVVVMSEEKAKELGVKPLATWVAGALGGVEPEIMGVGPVASTKK
VLAKTGLSIDDFDLIEANEAFAAQSIAVARDLGFDMSKVNVNGGAIALGHPVGASGCRIL
VTLLHEMQKRGSNRGLATLCIGGGMGCSTIVEKY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagttgtaatcgcaagtgcttgccgtacagcaatcggcaaaatgggcgga
gcattaagcaatactccagccgcagatttaggtgcaatcgtaattaaggaggctttaaac
cgtgcaggtgttgctcctgagatggttgacgaggttaagatgggttgtgttatccaggca
gctcagggacagaacgtagctcgtcaggcttctatcaaggcaggacttccaatcgaggtt
ccggctatcacaatcaatgtcgtttgtggatcaggtcttaagtgtgtaaacgacgctgct
acaatgatcaaagccggtgaggctgatatcgttgttgccggtggtatggagaacatgtca
atggctccttacgctatgacaaaggcacgtttcggatacagaatgaacaatgcaacaatc
atcgatacaatggttaacgatgctcttacagatgcattcaaccactatcatatgatgatc
acagctgagaacgtatgtgataaatacggcatcactcgtgaagagcttgatgagttctca
gcaaactcacagcagaagtgtgaggcagctatcgcagcaggcaagttcgatgatgagatc
gttcctgtacctgttaaggttaagaaagaaattgttgagttcaaaaaggacgagggacct
cgtgccggaacaacagtagagactctttctaagcttcgttgctgctcaggtaaagagggc
ggacttgttacagctggtaacgcatcaggaatcaatgatggtgctgcagcagtagttgta
atgagcgaagagaaagctaaggagctcggtgttaagccattagctacatgggtagcagga
gcacttggcggagttgagcctgagatcatgggtgttggaccggtagcttctacaaagaag
gttcttgcaaagacaggtctttcaattgatgatttcgatcttatcgaggcaaacgaggca
tttgctgcacagtcaatcgctgtagcaagagatcttggtttcgatatgagcaaggtaaat
gtaaacggtggtgctatcgcactcggacatcctgtaggagcttcaggctgtcgtatcctt
gttacattattacatgagatgcagaagagaggatctaacagaggtcttgcaacactttgt
atcggtggtggaatgggatgttctactatcgttgagaagtactaa

DBGET integrated database retrieval system