KEGG   Eubacterium rectale M104/1: ERE_29400Help
Entry
ERE_29400         CDS       T02588                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
era  Eubacterium rectale M104/1
Pathway
era00860  Porphyrin and chlorophyll metabolism
era01100  Metabolic pathways
Module
era_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:era00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ERE_29400
Enzymes [BR:era01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     ERE_29400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase MobB
Motif
Other DBs
NCBI-ProteinID: CBK94742
UniProt: D4JNS3
Position
complement(3022878..3024383)
Genome map
AA seq 501 aa AA seqDB search
MAKVIMVQGTMSNSGKSFLVAGLCRIFRQDGYRVAPFKSQNMALNSYITDEGLEMGRAQV
MQAEAAGIKPMVCMNPILLKPTNNTGSQVIVNGRVLKNMPAREYFAYKKTLIPDIKKAFK
KLEEYADIIVIEGAGSPAEINLKENDIVNMGLAHMVDAPVLLVGDIDRGGVFAQLLGTLM
LLTDEEKNRVCGLIINKFRGDKTILDPGIQMLEERGGVPVTGVVPYMDVQLEDEDSLTER
FDKKTDGLIDIAVIRYPRISNFTDFNVFEQMSEVTVRYVSTVNELRHPDIVFLPGSKNTM
GDLLWMRQNGLEAAVKKLSCEIPVFGICGGYQMLGASIADPDCVEEGGYMRGMELLPIDT
VLKDSKTRLQTSGEIAPVDGVLSRLSGCHFLGYEIHMGKSAYSAASDEQGACADRKNELN
NVISDGRNVYGSYIHGIFDTAEAARVIVDYIADKKGIDVNDSAILSYKSFKEKQYDRLAD
TLREYLDMDAVYGMLREAKYD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtaattatggtacagggtacaatgtccaattcaggcaagagctttcttgtc
gcgggcttgtgccgtattttcagacaggacggatacagggtggcaccgtttaaatcacag
aacatggcgctcaactcttatataacagacgaaggacttgagatgggacgggcacaggtg
atgcaggctgaggcagcaggcattaagcctatggtgtgcatgaatcctattcttttaaag
cccacaaataatacaggctcacaggtgattgtaaacggaagggtgcttaagaacatgccg
gcgagagagtattttgcatacaagaaaactctgataccggatataaaaaaggcgtttaaa
aagcttgaggagtatgctgatatcatagtgattgagggcgcaggaagcccggcggagata
aatctgaaggaaaatgatattgtaaacatggggcttgcgcatatggtggatgcaccggtg
ctgctcgtgggtgatatcgacagaggtggcgtttttgcgcagctgcttggcacacttatg
cttttaaccgatgaggaaaagaatcgtgtctgcgggcttattatcaataaattccgtgga
gacaagacgatccttgacccggggatacagatgcttgaggagagaggcggggtgcctgtc
accggagtggtgccatatatggatgtacagcttgaggatgaggacagcctgacagagcgc
tttgacaaaaagacagatgggcttattgatatagcggtcatcagatatccgagaatatca
aatttcacagatttcaatgtctttgagcagatgtccgaggtaacagtgcggtatgtgtca
acagtaaatgagctgcgtcatccggatatagtatttctgccgggaagcaagaatacgatg
ggggatcttttgtggatgagacaaaacggactcgaggccgctgtcaaaaagctctcctgt
gagatacctgtttttggaatatgcggaggctatcagatgcttggggcttcaatagccgac
cctgactgtgtcgaggagggcggatatatgcgtggcatggagcttcttcctatagatacc
gttctaaaagacagcaagacacggcttcagacaagcggtgaaatagcacctgtagatggt
gtattgagcaggctttcaggctgtcactttctgggctatgagatacatatgggtaagagc
gcatatagcgcagcttcagatgagcagggggcttgtgctgacaggaaaaatgagttaaat
aatgtcatatctgatggcagaaatgtgtatggctcgtacatccacggcatttttgatact
gcagaggccgccagagtgatagtggattatattgccgataaaaagggcattgatgtgaat
gacagcgctattttaagctataaaagcttcaaggaaaaacagtatgacaggcttgcggat
acactgagggagtatctggatatggatgcagtgtacggcatgcttcgtgaggcaaaatat
gattga

DBGET integrated database retrieval system