KEGG   Erysipelotrichaceae bacterium I46: A4V01_11675Help
Entry
A4V01_11675       CDS       T04439                                 

Definition
(GenBank) methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
erb  Erysipelotrichaceae bacterium I46
Brite
KEGG Orthology (KO) [BR:erb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:erb03009]
    A4V01_11675
Enzymes [BR:erb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A4V01_11675
Ribosome biogenesis [BR:erb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A4V01_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 DNA_ligase_ZBD Methyltransf_23 Methyltransf_32 Methyltransf_8 OrfB_Zn_ribbon Methyltransf_12 Methyltransf_9 MTS ComFB
Motif
Other DBs
NCBI-ProteinID: ANU69542
UniProt: A0A1C7HTX2
Position
2431576..2432394
Genome map
AA seq 272 aa AA seqDB search
MLLCPKCGNKLVREERVWRCQNNHSYDIAKRGYVNLALHHKALSGDDREMVKARTRFLSH
GYYAPLQAALVELVRDYHPSVVIDAGCGEGYYTNRVKQETDTLLGFDLSKYAVDEACKVR
SGAVYAVASVFHMPLCDACADMVLSVFAPFQAEEFLRVLQPGGIFIKVGPGPQHLMGLKE
ILYDVPYENPSETLQQEGFILEKTQMVEAAICIRDAADIQALFHMTPYYWKTPKDAAMRL
QELDELKTKIQFQIEIYRKDENMLNKQEQAML
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctgttatgtccgaaatgcggaaataaactggtcagggaggaacgcgtttggcgctgt
cagaataaccattcctatgacattgcaaagcgcggatatgtcaatctggcgctgcatcat
aaagcactcagcggggatgatcgggaaatggtaaaggcacgcacacgatttttatcccat
ggatattatgcaccgctgcaggctgcactggttgaactggtacgggactatcatccgtca
gtcgtcatagatgcaggctgtggagaggggtattatacgaacagagtgaaacaggaaacg
gatacactgcttggctttgacttatccaagtatgcagtcgatgaagcgtgcaaggtcaga
agcggtgcggtatatgcggtggcgagtgttttccatatgcccctgtgtgatgcctgtgcc
gatatggtgctttctgtgtttgcgccgtttcaggcagaggaatttctgcgtgtcttacag
ccgggtggtatcttcattaaggttggtcccggtccgcagcatctgatggggctcaaggaa
atcctgtatgatgtgccctatgaaaatccgtcggaaacgctgcagcaggagggcttcatt
ctggaaaaaacgcagatggtagaagctgctatctgtattcgggatgcagctgatattcag
gcactgtttcatatgacgccctattactggaaaacaccaaaggatgcggctatgcgcttg
caggagctggatgagctgaaaacgaaaattcagtttcaaatcgaaatctatcgcaaagat
gaaaacatgcttaacaaacaagagcaggctatgctataa

DBGET integrated database retrieval system