KEGG   Erysipelotrichaceae bacterium I46: A4V01_14705Help
Entry
A4V01_14705       CDS       T04439                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
erb  Erysipelotrichaceae bacterium I46
Pathway
erb00071  Fatty acid degradation
erb00280  Valine, leucine and isoleucine degradation
erb00310  Lysine degradation
erb00362  Benzoate degradation
erb00380  Tryptophan metabolism
erb00620  Pyruvate metabolism
erb00630  Glyoxylate and dicarboxylate metabolism
erb00640  Propanoate metabolism
erb00650  Butanoate metabolism
erb00900  Terpenoid backbone biosynthesis
erb01100  Metabolic pathways
erb01110  Biosynthesis of secondary metabolites
erb01120  Microbial metabolism in diverse environments
erb01130  Biosynthesis of antibiotics
erb01200  Carbon metabolism
erb01212  Fatty acid metabolism
erb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:erb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4V01_14705
   00630 Glyoxylate and dicarboxylate metabolism
    A4V01_14705
   00640 Propanoate metabolism
    A4V01_14705
   00650 Butanoate metabolism
    A4V01_14705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4V01_14705
   00072 Synthesis and degradation of ketone bodies
    A4V01_14705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4V01_14705
   00310 Lysine degradation
    A4V01_14705
   00380 Tryptophan metabolism
    A4V01_14705
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A4V01_14705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4V01_14705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A4V01_14705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:erb04147]
    A4V01_14705
Enzymes [BR:erb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A4V01_14705
Exosome [BR:erb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4V01_14705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANU70107
UniProt: A0A1C7HRM0
Position
2975749..2976957
Genome map
AA seq 402 aa AA seqDB search
MRKAYVVAAKRSAIGSFMGGLTNMPLVDLGAAVLSRTIEEAGIDPANIDEVIVGNVIAAG
LGQNIGRQVSIKAGVPVEVCAQSLNMLCGSGLKAVMEATMRIQCGFGDIFVAGGVESMTN
APYLVPSKVRNGVKMGDMKMVDSMLHDGLTDGMYGIHMGVTADNIAKKYSISREDQDAFA
YASQQKAIAAIDSGRFQDEIVPVEVPGRKGSVTVFDTDEHPNRASTPEKLAKLRPSFTKD
GTVTAGNASGINDGASFTIIASEDAVKKYNLTPLAEVIGIGQGGVDPRVMGLGPTPAILH
ALKYADLCIEDMELVELNEAFAAQSLGVIHELEEATGMDRNAFMEKTNVNGGAIALGHPV
GASGNRILVSLLHEMQKRDLKIGLASLCIGGGQGAAVIIKRV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcatatgtcgtagcagcaaagcgaagcgccatcggaagcttcatgggcggg
cttaccaacatgcccctggtagatctgggagctgctgttttaagcagaaccatcgaggag
gcaggcattgatcctgccaatatcgacgaggtgattgtcggaaacgtgattgcggcaggt
cttggtcaaaacatcggacgtcaggtcagcatcaaggccggtgtccctgttgaggtatgt
gcacagtccctgaatatgctgtgcggttccggattaaaggcggttatggaagctaccatg
cgcatccagtgcggattcggcgatatctttgtagccggtggtgtggaatctatgaccaat
gcaccgtatctggtgcctagtaaggtgcgaaacggtgtgaagatgggtgacatgaagatg
gtggattccatgctgcatgatggattaacagatggtatgtatgggatacacatgggtgtt
accgcagataatatagcgaaaaagtattccatttcccgtgaggatcaggacgcctttgcc
tatgcatcccagcagaaggcaatcgctgccatcgattccgggcgctttcaggatgaaatc
gtgccggtagaagtacccggccgtaagggcagtgtgacggtatttgacaccgatgagcac
ccgaaccgtgcctccacgccggaaaagctggcaaagctgcgtccctctttcacaaaggac
ggtaccgttactgccggaaatgcttccggtatcaatgacggtgccagctttacaatcatc
gccagtgaggatgccgttaagaaatacaatctgacaccgcttgcggaagtcatcggcatc
ggtcagggcggtgtagatccacgcgtcatgggtcttggtcctacgcctgctattctgcat
gcgctgaagtatgctgacctgtgcatcgaggacatggagctcgtagagctgaatgaagcg
tttgctgcacagtctctgggtgtcattcatgaactggaggaagcaaccggcatggatcgt
aacgcctttatggaaaaaaccaacgtcaatggtggagcaatcgcactgggacatccggtc
ggtgcatccggaaaccgaattctggtgagtcttcttcacgaaatgcagaagcgcgatttg
aaaatcggactggcttccctgtgcatcggcggcggacagggtgctgcagtcatcatcaaa
cgtgtataa

DBGET integrated database retrieval system