KEGG   Eremothecium cymbalariae: Ecym_2022Help
Entry
Ecym_2022         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
erc  Eremothecium cymbalariae
Pathway
erc03013  RNA transport
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ecym_2022
Messenger RNA biogenesis [BR:erc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Ecym_2022
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Ecym_2022
Translation factors [BR:erc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Ecym_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF4E Toprim_Crpt
Motif
Other DBs
NCBI-GeneID: 11472980
NCBI-ProteinID: XP_003644598
UniProt: G8JNY1
Position
2:complement(33898..34605)
Genome map
AA seq 235 aa AA seqDB search
MHRQKVRALISLLPPHHCVIIINMSVEEVTQKTQGLSVSENQEGQTVLSNSKDFNLKHPL
NSKWTLWYTKPPVGENESWSDLLRPVTSFTTVEEFWAIQQSIPRPRELPLKSDYHLFRDD
IRPEWEDEANSKGGKWSFQFKSARAPHIDDLWLRALLAVIGESIDEDDSEINGVVVNVRR
SGYKIGLWTKSVDQEPLSKVGAKFKAVLQLEESDKLEFFAHSSANDKNARPTLVL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcataggcaaaaggtaagagccttaatatctctgctaccccctcaccattgtgttata
atcatcaatatgtctgtagaagaagttactcagaagacgcaagggttgtccgtttcagaa
aatcaagaaggccaaactgtgctatctaacagcaaggacttcaatttgaaacatccatta
aactcaaaatggactctttggtataccaagcctccggtcggggaaaacgagtcttggtct
gatttattgcgcccggttacatcctttactactgttgaagagttttgggctatccagcag
tcgattcctagacctcgtgaacttcccttgaagtcggattaccatttattccgcgatgac
atcaggccagagtgggaagatgaggccaactccaagggaggtaagtggtctttccagttc
aaaagtgcaagggcgccacatatagatgatttgtggctaagggccctattggctgtcatt
ggtgaatctatcgatgaggatgattctgaaatcaacggtgttgtggtgaacgtgagaaga
tcagggtacaagattgggttgtggaccaagtctgtagaccaggagccattgtccaaggtt
ggtgcaaagtttaaggcggtgctgcagttggaggaatctgacaagttggaatttttcgct
cactcttctgctaacgataaaaacgctagaccaactctagttttgtag

DBGET integrated database retrieval system