KEGG   Eremothecium cymbalariae: Ecym_2034Help
Entry
Ecym_2034         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K10739  replication factor A2
Organism
erc  Eremothecium cymbalariae
Pathway
erc03030  DNA replication
erc03420  Nucleotide excision repair
erc03430  Mismatch repair
erc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ecym_2034
   03420 Nucleotide excision repair
    Ecym_2034
   03430 Mismatch repair
    Ecym_2034
   03440 Homologous recombination
    Ecym_2034
DNA replication proteins [BR:erc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Ecym_2034
DNA repair and recombination proteins [BR:erc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Ecym_2034
   MMR (mismatch exicision repair)
     Ecym_2034
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Ecym_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPA_C tRNA_anti-codon CDC24_OB3 Barwin
Motif
Other DBs
NCBI-GeneID: 11470466
NCBI-ProteinID: XP_003644609
UniProt: G8JNZ2
Position
2:join(54071..54077,54156..54991)
Genome map
AA seq 280 aa AA seqDB search
MATYQQQPFNEYSSVSGGGFDNSQASAGKPNSAGGQTTATLTPVTIKQILEAKQFVQDGP
YVVNNIELHNICFVGVVRNVVDHTANVNVTVEDGTGQLEFRQWSNDQKDIERASQGEKGE
YNSEVSQQFQIGSYVKVFATLREFGGKMNIQYALVKPIENFNEVIAHHLSAIKCYALANG
KLAHPTSAVGTGTSTGQESNAQSLFVQDNDFSNAKPATQRILDFCRDQCRDKDANTFSVH
TKLIAQSLGMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggctacttatcaacagcaaccctttaatgaatattccagcgtttctggtggagggttt
gataattcccaggcttcagcgggcaaaccaaactcagcaggggggcagaccacagccact
ttgacccctgtgaccataaaacaaatactagaagctaaacaatttgtacaagatgggcct
tatgttgtaaataacattgagttgcataatatatgttttgtcggtgtggtaagaaacgtc
gtagaccacactgcaaacgtcaatgtgaccgtggaggatggaactgggcagcttgaattt
agacaatggagcaatgatcaaaaggatattgaacgagcaagccaaggcgagaagggcgag
tacaactccgaggtttcacaacaattccagattggatcttacgtcaaggtatttgccacg
ttaagagaattcggggggaaaatgaacatccagtatgcactagtaaagcctatagaaaac
tttaatgaagtgattgcccaccatctatcggccatcaagtgttatgcactagcaaacggt
aagctagcacatcccacatctgcagttggaacgggtacttccactggccaggagtcaaat
gcacagagcttgtttgtgcaagataacgatttcagcaatgcaaaacccgctacacaaagg
atcttggatttctgcagagatcaatgcagagacaaagatgcaaatacattttctgttcac
actaagttaattgcgcaatctctcggtatgttagaggacgatgtgagaatgcactgtcag
acactaaccgaacaaggtttcatatatcccacctttgatgagaacagctatttcacgtta
tga

DBGET integrated database retrieval system