KEGG   Eremothecium cymbalariae: Ecym_3221Help
Entry
Ecym_3221         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K19786  inositol-pentakisphosphate 2-kinase [EC:2.7.1.158]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00562  Inositol phosphate metabolism
erc01100  Metabolic pathways
erc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Ecym_3221
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Ecym_3221
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.158  inositol-pentakisphosphate 2-kinase
     Ecym_3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ins_P5_2-kin
Motif
Other DBs
NCBI-GeneID: 11468779
NCBI-ProteinID: XP_003645535
UniProt: G8JRE9
Position
3:complement(417172..417996)
Genome map
AA seq 274 aa AA seqDB search
MAHIVAKGAANYLIALNHNEDVLYRVCTRYPSLRENNAYNIKNYDYIMQVIPSAIRKYIC
PIELVELDTEIFKRCSNVPIKAWDSSSVACFKLKNLVPKDTKPIKLDHYTKLHIGNKKII
WEFKPKWLSQDTAYCRNCTLNNLRGHSIPYCYAQLLEDSKIAEVINLIFKDINVPEEFLI
DLKAYLRSNTNVLKIIFIVQEQVDKSLQASAAGESIDHYRLSMTLKDLTCFIEWKPESPI
EAKIVDLDQKPSDKLDCWAELRNQLETFHDKVTH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggctcacatagttgctaaaggtgctgctaattatttaattgcattgaaccataatgaa
gatgtgctctacagggtctgcacgagatatccaagccttcgagaaaacaatgcttataac
atcaaaaactatgactacattatgcaagtgataccgtcagcaatcaggaaatatatatgt
ccaatagagctggtggaattagatactgagatattcaagaggtgctctaatgttccaatt
aaggcctgggactcatcaagcgttgcttgcttcaaattgaaaaatttggtacccaaggat
acaaaacccattaagcttgaccattacactaaattacacataggcaacaaaaagataatc
tgggagtttaaaccaaagtggttgagccaggatactgcatactgtaggaattgcacactg
aataatctaagaggacattccattccctattgttatgcccagttattggaggattccaag
atagctgaagtaataaatctgatctttaaggacattaatgtaccagaagagtttttaatt
gacctcaaggcttatttaagaagtaacacaaatgtcctgaaaataatcttcattgtacag
gaacaagttgacaagagtttacaagcatccgctgctggagagtcaattgaccactataga
ttatcaatgacattaaaggatttgacctgtttcatcgaatggaaacccgagtctcctata
gaggctaaaatagttgatcttgaccaaaagccatcagataaactcgattgctgggctgaa
cttagaaaccaattggaaacatttcacgacaaagttacgcactag

DBGET integrated database retrieval system