KEGG   Eremothecium cymbalariae: Ecym_3265Help
Entry
Ecym_3265         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00020  Citrate cycle (TCA cycle)
erc00480  Glutathione metabolism
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01200  Carbon metabolism
erc01210  2-Oxocarboxylic acid metabolism
erc01230  Biosynthesis of amino acids
erc04146  Peroxisome
Module
erc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecym_3265
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ecym_3265
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Ecym_3265
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Ecym_3265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh NTP_transf_6
Motif
Other DBs
NCBI-GeneID: 11468841
NCBI-ProteinID: XP_003645575
UniProt: G8JRI9
Position
3:504267..505541
Genome map
AA seq 424 aa AA seqDB search
MYFRRYLLTATRTSRPKIKVQSPLVELDGDEMTRIIWDKIKTKLILPYLDIDLKYYDLSI
TSRDASNDQITHDAAHAIKKYGVGVKCATITPDEARVEEFNLKKMWKSPNGTIRNILGGT
VFREPIVIPRIPRLIPGWEKPIIIGRHAHGDQYKATDLLVPGAGKLELLYRPADGSTPTT
LDVYEYKDSGIAMAMYNTDESIRGFAHASFKLALTKKLNLFLSTKNTILKTYDGRFKDIF
QELYDTQYKTEFENHGIYYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGS
LGLMTSILATPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLIKRGELD
NTPDVVNFANKLEAATVNTVQEDGLMTKDLALACGNTDRSAYVTTNELLDAVEARLKEDL
AVVE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcagaagataccttttgaccgcaacgagaacgagcagacccaagattaaagtt
caatctccccttgtggagctggatggggatgaaatgactagaattatctgggataaaatt
aaaaccaagttgattttgccgtatctcgatatagatttgaagtattatgatttaagtatt
acttcccgtgatgcatccaatgatcaaataacccatgatgctgcacacgcaattaagaag
tatggcgttggggtcaagtgtgcaactatcacaccagatgaggcccgtgtggaagaattt
aacttaaagaagatgtggaaatctccaaatgggacgattagaaatattttgggtggaact
gtctttcgggagccaattgtgattccaagaatcccaaggttgattcctggatgggaaaaa
ccaattatcattggaagacatgcgcatggtgaccaatacaaagctactgatctgttggtc
ccaggtgctggtaagctggaattgctttataggcctgccgatgggtctactcccactacg
ttggatgtatatgaatacaaagattccggaattgccatggcaatgtacaatacagacgag
tctattcgtgggtttgcccatgcctccttcaaactggccttgaccaagaagttaaatttg
ttcctttctacgaagaacaccatccttaaaacgtatgatggccgctttaaagatatattc
caagaactgtacgatactcaatataagacggagtttgaaaatcatgggatctattatgaa
catcgtttgattgacgatatggttgcccagatgataaagtcgaaaggtggttttattatg
gccttgaagaattatgacggtgacgttcagtccgacattgtcgctcagggtttcggatct
ctgggtttgatgacatccatccttgcaacaccagacggaaaaacctttgaaagtgaggct
gcccatggaactgtcaccagacattatagacaacatcaacaaggtaaagaaacctcgacg
aactccatcgcctccatttttgcttggaccagaggcttgataaaaaggggtgagttggac
aataccccagatgtcgttaactttgccaacaagttagaagctgcaacagtaaacactgtt
caagaagacggcctcatgaccaaggatctggctctggcatgcggcaatacggataggtct
gcatacgtcacaacaaacgaattgctggacgctgtggaggctagattgaaggaagatttg
gcagttgttgaataa

DBGET integrated database retrieval system