KEGG   Eremothecium cymbalariae: Ecym_3522Help
Entry
Ecym_3522         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00010  Glycolysis / Gluconeogenesis
erc00030  Pentose phosphate pathway
erc00051  Fructose and mannose metabolism
erc00052  Galactose metabolism
erc00680  Methane metabolism
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01200  Carbon metabolism
erc01230  Biosynthesis of amino acids
erc03018  RNA degradation
Module
erc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ecym_3522
   00030 Pentose phosphate pathway
    Ecym_3522
   00051 Fructose and mannose metabolism
    Ecym_3522
   00052 Galactose metabolism
    Ecym_3522
  Energy metabolism
   00680 Methane metabolism
    Ecym_3522
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ecym_3522
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ecym_3522
Protein phosphatases and associated proteins [BR:erc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ecym_3522
Messenger RNA biogenesis [BR:erc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ecym_3522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat UVR
Motif
Other DBs
NCBI-GeneID: 11472302
NCBI-ProteinID: XP_003645817
UniProt: G8JQL6
Position
3:986690..989656
Genome map
AA seq 988 aa AA seqDB search
MSMEAVYGVGFTSLTTAEEDKYKATIKFYQELGFSIVKIYDKFKNHDNGVIASGTTHGSR
KETWLESFKLSEMDARGFRVPQQEASNPEQSDGILLKIRLVSEISTVGGQSFDVRYYSAV
FEEAAEKFPERTAVGDNAFKVKDPLGNVITITNVPRLEDGLHGPAKVLDAAHFTAKKDAE
TEEHEELSALRKSLGVTGIPDYGSADGKMKKRIAVMTSGGDSPGMNAAVRAVVRAGIYYR
CDVFAVYEGYEGLLKGGDLLKKMQWSDVRGWLSEGGTLIGTARCMGFKQREGRKKAAANL
IERGIDALVVCGGDGSLTGADLFRSEWPSLVEELVAEGRFTSRQVAPYKNLTIVGLVGSI
DNDMSGTDSTIGAYSALERICEMVDFIDATAKSHSRAFVVEVMGRHCGWLALMAGIATAA
DYIFIPERAAPYGKWQDDLKKVCQRHKLKGRRNITVILAEGALDNNLNPITAEEVKKSLV
ELGLDTRITTLGHVQRGGTAVAHDRWLATLQGVDAVKAVLEMTPDTPSPLIGILENKIIR
MPLMESVKLTKQVATAIEAKDFEKAISLRDTEFIELYENFIATTIRDDGTEYVPEDERLK
IAILHVGAPSAALNAATRAATLYCLSHGHKPFAILNGFSGLIQEGEVKELTWIDVENWHN
LGGSEIGTNRCVAAEDLGTVAYHFQKNEFDGVIILGGFEGFKSLKQLNEAKEQYPIFNIP
IVLIPATVSNNVPGTEYSLGTDTCLNSLVNYTDAIKQSASASRRRVFVVEVQGGHSGYVA
SFTGLVTGAVSVYIPEQNIDLKSIQEDLALLKENFRHDQGENRNGKILIRNEQASSIYST
EMIADIISESSKGRFGVRTAVPGHVQQGGVPSSKDRVAASRFAVKCVKFIENWNKCNMNT
SRDNKLLGSRRSKNPTNDENSSAAVICVNGSTVSFKPIDKLWEYETNVELRKGREIHWAE
FTKIGDILSGRSNLRKEITAAKKATLQI
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatggaagcagtatatggagtggggtttacgtctttgacgacggcggaggaggat
aagtataaagctaccatcaaattttatcaagagttggggttctctatagtaaagatatat
gataagttcaagaaccatgacaatggtgttattgcttcagggacgacgcacggatcgcgt
aaagaaacttggctagagtcgttcaagttgtctgagatggatgcgaggggatttcgtgtg
ccccagcaggaggcgtcgaatccagaacaatcggatggtatcttgttgaagattaggtta
gttagtgaaattagcactgtcgggggtcaatctttcgatgtgaggtactacagtgctgtg
tttgaagaagcggcggagaagtttcctgaacggacggctgtgggggataatgcattcaag
gtgaaggatcctttgggaaatgtgattactattacgaatgttccacgcttggaggacggt
ttgcatggtcctgcaaaggttttggatgctgcgcactttactgctaagaaagatgcagaa
acggaagaacatgaagagttatcagcgctgagaaaaagcttgggtgttacaggcattcct
gattatggtagtgccgatgggaagatgaagaagaggattgcagtgatgacttctggaggt
gattcaccgggtatgaatgctgctgtgcgtgcagtagtgcgggctggtatttattatcgc
tgcgatgtgtttgcggtttacgaaggatatgaggggttgttaaagggtggggacctcttg
aagaagatgcaatggtctgatgtgaggggctggttgagcgaaggtggtacactgatcggt
accgcacgttgtatgggattcaagcagcgcgaaggtaggaaaaaggcagcagcaaacttg
attgaacgtggtattgatgcgttagtagtctgtggaggtgatgggtctctcactggagct
gatttatttagatctgagtggccatcattagttgaagagttggttgcagaaggtaggttt
acctccaggcaagtagctccttataagaatttaacaattgtaggattggtgggctcaatt
gacaacgatatgtctggtacagactccacaatcggtgcttattctgctttggaacggatt
tgcgagatggttgatttcattgatgcaacagctaaatcacattctcgtgcgtttgttgtt
gaagttatggggagacactgtggttggttggcattgatggcaggtattgctactgctgct
gactacatctttatcccagaaagagcagctccatacgggaaatggcaagatgatctcaaa
aaggtctgtcaaagacataaactaaagggacgtcgtaatattactgttattttagcggaa
ggtgctttagacaacaatttgaatccaataaccgctgaagaagtcaaaaaatctttggtt
gagttgggcttggatactagaattaccactttgggtcatgttcaaagaggtggaaccgca
gtagcacatgatagatggttggccacgttgcagggtgtagatgctgtaaaagctgtattg
gagatgactccagacacgccctcaccactgattggtattctggagaacaaaattattaga
atgcctttgatggagtctgtcaaattgacgaagcaagttgccactgctatcgaggctaaa
gattttgagaaggctatttctttgcgtgatacagaattcattgagctgtacgaaaacttc
atcgctactactattagggatgatggaactgaatacgttccggaagacgaaagattgaaa
attgctattttgcatgttggtgctccctctgcagctttaaatgcagctacccgcgctgca
actttgtactgtttgtctcatggccataagccatttgctattttgaatgggttttctggt
ctaattcaggaaggtgaggtcaaggaattaacttggatcgacgttgagaattggcacaac
cttggtggttccgagatcggcactaatcgttgcgtagctgcggaagacttaggtactgtg
gcgtaccactttcagaagaatgaatttgatggagttatcattttgggtggatttgaaggt
ttcaagtctttgaaacagcttaacgaagctaaagagcaatatcctattttcaatattcct
attgtactaatacctgccactgtttccaataacgtaccaggtactgaatattctttaggc
accgacacttgtttgaactctttggtgaattacactgacgcgattaaacaatcagcgtct
gcctccagaaggagagttttcgttgtggaagtccaaggtggtcattctggatatgttgca
tcttttactggcttggtaacaggtgctgtgtccgtttatattcctgagcaaaatattgac
ttgaagtctattcaggaagatttggctttattaaaggaaaactttcgccatgatcagggt
gaaaaccgtaatggtaagatcctcatcagaaatgaacaggcatcatctatatatagtaca
gagatgattgcagatatcatatccgaatcatcaaagggcagatttggcgtcagaactgct
gttccaggccacgttcaacaaggtggtgttccatcctctaaagatagagtcgctgcttcg
cgtttcgccgtaaaatgtgtcaaattcattgaaaattggaacaagtgtaatatgaatact
tcaagggacaataaactactaggttcaagacgctcaaaaaatcctacaaacgatgaaaat
agctctgcagcagtcatctgcgttaatggctcaacagtatccttcaagccaattgataaa
ctatgggaatacgaaactaacgtagaattgagaaaaggtagagaaattcactgggctgag
ttcaccaaaatcggagatattttatctggcagaagcaatctgagaaaagaaatcacggct
gcaaagaaagccactttgcaaatttaa

DBGET integrated database retrieval system